GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-07-24 00:01:43, GGRNA.v2 : RefSeq release 224 (May, 2024)

LOCUS       XM_001314580            1311 bp    mRNA    linear   INV 01-MAR-2023
DEFINITION  Trichomonas vaginalis G3 Ankyrin repeat family (TVAGG3_0863970),
            partial mRNA.
ACCESSION   XM_001314580
VERSION     XM_001314580.2
DBLINK      BioProject: PRJNA938429
            BioSample: SAMN31107788
KEYWORDS    RefSeq.
SOURCE      Trichomonas vaginalis G3
  ORGANISM  Trichomonas vaginalis G3
            Eukaryota; Metamonada; Parabasalia; Trichomonadida;
            Trichomonadidae; Trichomonas.
REFERENCE   1  (bases 1 to 1311)
  AUTHORS   Sullivan,S.A., Carlton,J.M. and Schatz,M.C.
  TITLE     A new chromosome-level assembly of the sexually transmitted
            parasite Trichomonas vaginalis
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 1311)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (28-FEB-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1311)
  AUTHORS   Sullivan,S.A., Carlton,J.M. and Schatz,M.C.
  TITLE     Direct Submission
  JOURNAL   Submitted (15-FEB-2022) Center for Genomics & Systems Biology, New
            York University, 12 Waverly Place, New York, NY 10003, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_067208).
            
            On Oct 20, 2022 this sequence version replaced XM_001314580.1.
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1311
                     /organism="Trichomonas vaginalis G3"
                     /mol_type="mRNA"
                     /strain="G3"
                     /isolation_source="clinical isolate"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:PRA-98"
                     /db_xref="taxon:412133"
                     /chromosome="VI"
                     /country="United Kingdom: Beckenham"
                     /collection_date="1973"
     gene            <1..>1311
                     /locus_tag="TVAGG3_0863970"
                     /old_locus_tag="TVAG_2v0863970"
                     /note="replaces TrichDB:TVAG_275690"
                     /db_xref="GeneID:4760133"
     CDS             1..1311
                     /locus_tag="TVAGG3_0863970"
                     /old_locus_tag="TVAG_2v0863970"
                     /note="eggNOG seed ortholog:5722.XP_001314610.1;replaces
                     TrichDB:TVAG_275690"
                     /codon_start=1
                     /product="Ankyrin repeat family"
                     /protein_id="XP_001314610.1"
                     /db_xref="GeneID:4760133"
                     /translation="
MNWEIPLFILPQNAIVKKQPNFLFHMVQISMKRMNLEIPLFILPQNAIVKKQPNFLFHMVQISMKRMNFGRTALHIAAEHNRKETAELLISHGANVNEKDNFGRTALHIAAEHNSKETAKLLISHGANVNEKDELGNTALHIAAECNSKETAELLISHGANVNEKDNFGRTALHIAAECNSKETAKLLISHGANVNEKDELGNTALHIAAECNSKETAELLISHGANVNEKDNFGRTALHIAAECNSKETAKLLISHGANVNEKDELGNTALHIAAECNSKETAKLLISHGANVNEKDELGNTALHIAAECNSKETAELLISHGANVNEKDNFGRTALHIAAECNSKETAELLISHGANVNEKDNFGRTALHYAVKNKSKEIVELLISHGANINEKDELGNTALRKAAIFNSKKTAELLISHGANINEKDEYGNTC"
     misc_feature    160..1014
                     /locus_tag="TVAGG3_0863970"
                     /old_locus_tag="TVAG_2v0863970"
                     /note="Ankyrin repeat [Signal transduction mechanisms];
                     Region: ANKYR; COG0666"
                     /db_xref="CDD:440430"
     misc_feature    order(205..207,211..213,223..228,235..243,247..252,
                     262..264,271..273,298..300,304..306,310..312,322..327,
                     334..342,346..351,361..363,370..372,397..399,403..405,
                     409..411,421..426,433..441,445..450,460..462,469..471,
                     496..498)
                     /locus_tag="TVAGG3_0863970"
                     /note="oligomer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:293786"
     misc_feature    205..300
                     /locus_tag="TVAGG3_0863970"
                     /old_locus_tag="TVAG_2v0863970"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     misc_feature    304..399
                     /locus_tag="TVAGG3_0863970"
                     /old_locus_tag="TVAG_2v0863970"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     misc_feature    403..498
                     /locus_tag="TVAGG3_0863970"
                     /old_locus_tag="TVAG_2v0863970"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     misc_feature    502..597
                     /locus_tag="TVAGG3_0863970"
                     /old_locus_tag="TVAG_2v0863970"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     misc_feature    604..696
                     /locus_tag="TVAGG3_0863970"
                     /old_locus_tag="TVAG_2v0863970"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     misc_feature    order(607..609,619..624,631..639,643..648,658..660,
                     667..669,694..696,700..702,706..708,718..723,730..738,
                     742..747,757..759,766..768,793..795,799..801,805..807,
                     817..822,829..837,841..846,856..858,865..867,892..894)
                     /locus_tag="TVAGG3_0863970"
                     /note="oligomer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:293786"
     misc_feature    700..795
                     /locus_tag="TVAGG3_0863970"
                     /old_locus_tag="TVAG_2v0863970"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     misc_feature    799..894
                     /locus_tag="TVAGG3_0863970"
                     /old_locus_tag="TVAG_2v0863970"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     misc_feature    901..993
                     /locus_tag="TVAGG3_0863970"
                     /old_locus_tag="TVAG_2v0863970"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     misc_feature    order(904..906,916..921,928..936,940..945,955..957,
                     964..966,991..993,997..999,1003..1005,1015..1020,
                     1027..1035,1039..1044,1054..1056,1063..1065,1090..1092,
                     1096..1098,1102..1104,1114..1119,1126..1134,1138..1143,
                     1153..1155,1162..1164,1189..1191)
                     /locus_tag="TVAGG3_0863970"
                     /note="oligomer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:293786"
     misc_feature    913..1191
                     /locus_tag="TVAGG3_0863970"
                     /old_locus_tag="TVAG_2v0863970"
                     /note="Ankyrin repeats (3 copies); Region: Ank_2;
                     pfam12796"
                     /db_xref="CDD:463710"
     misc_feature    997..1092
                     /locus_tag="TVAGG3_0863970"
                     /old_locus_tag="TVAG_2v0863970"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     misc_feature    1096..1191
                     /locus_tag="TVAGG3_0863970"
                     /old_locus_tag="TVAG_2v0863970"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     misc_feature    1195..1290
                     /locus_tag="TVAGG3_0863970"
                     /old_locus_tag="TVAG_2v0863970"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     misc_feature    1198..>1308
                     /locus_tag="TVAGG3_0863970"
                     /old_locus_tag="TVAG_2v0863970"
                     /note="Ankyrin repeats (many copies); Region: Ank_4;
                     pfam13637"
                     /db_xref="CDD:372654"
ORIGIN      
atgaattgggaaataccgctcttcatattgccgcagaatgcaatagtaaagaaacagccgaacttcttatttcacatggtgcaaatatcaatgaaaaggatgaatttggaaataccgctcttcatattgccgcagaatgcaatagtaaagaaacagccgaacttcttatttcacatggtgcaaatatcaatgaaaaggatgaatttcggaagaaccgctcttcatattgccgcagaacacaatagaaaagaaacagccgaacttcttatttcacatggtgcaaatgtcaatgaaaaagataatttcggaagaaccgctcttcatattgccgcagaacacaatagtaaagaaacagccaaacttcttatttcacatggtgcaaatgtcaatgaaaaggatgaattgggaaataccgctcttcatattgccgcagaatgcaatagtaaagaaacagccgaacttcttatttcacatggtgcaaatgtcaatgaaaaagataatttcggaagaaccgctcttcatattgccgcagaatgcaatagtaaagaaacagccaaacttcttatttcacatggtgcaaatgtcaatgaaaaggatgaattgggaaataccgctcttcatattgccgcagaatgcaatagtaaagaaacagccgaacttcttatttcacatggtgcaaatgtcaatgaaaaagataatttcggaagaaccgctcttcatattgccgcagaatgcaatagtaaagaaacagccaaacttcttatttcacatggtgcaaatgtcaatgaaaaggatgaattgggaaataccgctcttcatattgccgcagaatgcaatagtaaagaaacagccaaacttcttatttcacatggtgcaaatgtcaatgaaaaggatgaattgggaaataccgctcttcatattgccgcagaatgcaatagtaaagaaacagccgaacttcttatttcacatggtgcaaatgtcaatgaaaaagataatttcggaagaaccgctcttcatattgccgcagaatgcaatagtaaagaaacagccgaacttcttatttcacatggtgcaaatgtcaatgaaaaagataatttcggaagaaccgctcttcattatgcagttaaaaataagagtaaagaaatagtcgaacttctaatttcacatggtgcaaatatcaatgaaaaggatgaattgggaaataccgctcttcgtaaggcagctattttcaatagtaaaaaaacagcggaacttcttatttcacatggtgcaaatatcaatgaaaaagatgaatatggaaatacttgctga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]