GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2021-01-24 05:50:42, GGRNA.v2 : RefSeq release 203 (Nov, 2020)

LOCUS       XM_001263935            1410 bp    mRNA    linear   PLN 20-AUG-2020
DEFINITION  Aspergillus fischeri NRRL 181 PAZ domain protein (NFIA_024180),
            partial mRNA.
ACCESSION   XM_001263935
VERSION     XM_001263935.1
DBLINK      BioProject: PRJNA18475
            BioSample: SAMN02953637
KEYWORDS    RefSeq.
SOURCE      Aspergillus fischeri NRRL 181 (Neosartorya fischeri NRRL 181)
  ORGANISM  Aspergillus fischeri NRRL 181
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Eurotiomycetes; Eurotiomycetidae; Eurotiales; Aspergillaceae;
            Aspergillus; Aspergillus subgen. Fumigati.
REFERENCE   1  (bases 1 to 1410)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (20-AUG-2020) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   2  (bases 1 to 1410)
  AUTHORS   Nierman,W.C.
  TITLE     Direct Submission
  JOURNAL   Submitted (26-OCT-2006) The Institute for Genomic Research, 9712
            Medical Center Drive, Rockville, MD 20850, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_001509769).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1410
                     /organism="Aspergillus fischeri NRRL 181"
                     /mol_type="mRNA"
                     /strain="NRRL 181"
                     /type_material="culture from neotype of Aspergillus
                     fischeri"
                     /db_xref="taxon:331117"
                     /chromosome="Unknown"
     gene            <1..>1410
                     /locus_tag="NFIA_024180"
                     /db_xref="GeneID:4590588"
     CDS             1..1410
                     /locus_tag="NFIA_024180"
                     /note="encoded by transcript NFIA_024180A;
                     predicted by EVM"
                     /codon_start=1
                     /product="PAZ domain protein"
                     /protein_id="XP_001263936.1"
                     /db_xref="GeneID:4590588"
                     /translation="
MEDYKHQNKLTGGLRHLHVDTTDDVAKYTISVKTVTRPNHRQTGKEIEVLMNAYPITKFPTCNVYQYDVQIRNGVEKNIIIKKVWNSNARKAALKQIIFDGQKLAWSMNNYSNSLNMVVDLNQEQGRPAGRTSNTFHLTVRRKTVNLAVLNAWLTGRTSMSEAVLEAMNFLDHVLREHPSGKFLALRRSFFDEKGDNQDLGNGVLAFKGVYQAIRPALGRGLIVNVDVSNSCFWARTSFMGAAMVVLDCRDHQHLMHVLKPISDGYGGVTKSTSFYKVHRRLQKLGVQPHYRGCPCTGVDFTVKGLLHANARQYMIKIKDKATGKTEKMSVEAYFKKKYNLTLNYWELPMVEMTKKGVVYLMEVLTIHRLHRYPWKLNEYQTSVMIKYAASRPADHLNSIYKLKAILNHAKDPVLNTFGLAIKDDMIRTKARLLPSPDIQFGGNQCLSPGTNGHWDLCGKKFYQPTRDH"
     misc_feature    109..525
                     /locus_tag="NFIA_024180"
                     /note="N-terminal domain of argonaute; Region: ArgoN;
                     pfam16486"
                     /db_xref="CDD:293095"
     misc_feature    559..702
                     /locus_tag="NFIA_024180"
                     /note="Argonaute linker 1 domain; Region: ArgoL1;
                     pfam08699"
                     /db_xref="CDD:285861"
     misc_feature    754..1104
                     /locus_tag="NFIA_024180"
                     /note="PAZ domain, argonaute_like subfamily. Argonaute is
                     part of the RNA-induced silencing complex (RISC), and is
                     an endonuclease that plays a key role in the RNA
                     interference pathway. The PAZ domain has been named after
                     the proteins Piwi,Argonaut, and Zwille; Region:
                     PAZ_argonaute_like; cd02846"
                     /db_xref="CDD:239212"
     misc_feature    order(901..903,946..948,991..993,1003..1005,1057..1059,
                     1072..1074,1078..1080)
                     /locus_tag="NFIA_024180"
                     /note="nucleic acid-binding interface [nucleotide
                     binding]; other site"
                     /db_xref="CDD:239212"
     misc_feature    1237..>1401
                     /locus_tag="NFIA_024180"
                     /note="Piwi-like: PIWI domain. Domain found in proteins
                     involved in RNA silencing. RNA silencing refers to a group
                     of related gene-silencing mechanisms mediated by short RNA
                     molecules, including siRNAs, miRNAs, and
                     heterochromatin-related guide RNAs. The...; Region:
                     Piwi-like; cl00628"
                     /db_xref="CDD:294420"
ORIGIN      
atggaggactacaagcaccagaacaaacttacaggcggccttcgccatcttcatgttgatactactgatgatgttgccaagtacactatttcagttaagacagttactcgcccaaaccacaggcagactggcaaggagatagaagttcttatgaatgcctatcccatcaccaaattccccacctgcaacgtctaccaatacgatgtgcaaatcagaaatggtgttgaaaagaatatcatcattaagaaggtctggaattccaatgctcgcaaggccgccttgaagcagatcatctttgatggtcagaagcttgcctggtctatgaacaactactctaacagtttgaacatggttgtcgatctcaatcaagaacagggtcgccctgctggtagaaccagcaacaccttccatctgactgttcgccggaagactgtcaacctggctgttctcaacgcctggcttactggacgcacctctatgtcagaggcggtccttgaggctatgaacttcctggaccatgtccttcgcgagcatcctagcggcaaattcctggcccttcgtcgctccttcttcgatgagaaaggtgataaccaggatctcggaaacggcgtcttggccttcaagggtgtctaccaggcgatccgtcctgcactgggccgcggtctcattgtcaatgtcgatgtgtccaactcctgcttctgggcgcggacctctttcatgggcgccgccatggtggtgcttgattgtcgggaccatcagcatctgatgcatgttctcaagcctatcagtgacggctatggtggtgttactaagtcaactagcttttataaggtccatcgtcgccttcaaaagctcggggtccagccgcattacagaggctgcccttgcactggtgttgatttcactgtcaagggattgctccatgccaacgctcgacaatatatgatcaagattaaggataaagccactggaaaaaccgagaagatgagtgtggaggcgtactttaagaagaagtacaacctgaccttgaactactgggagcttcctatggttgagatgacgaagaaaggcgttgtctacctaatggaagtgttgacgatccacagactccaccgttacccatggaagttgaatgagtatcagacttcagtaatgatcaagtatgctgcatcacgtcctgcggatcatctcaattccatttataagttaaaggctatactcaaccacgcaaaagaccctgttctcaacactttcggccttgccatcaaagatgatatgattcgcaccaaggcccgtctcttgcctagccccgacattcagtttggtggaaaccagtgcctctctcctggcaccaacggccattgggatctttgtggcaagaaattctatcagccaacaagagaccattag
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]