2024-04-26 07:32:34, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_208002 438 bp mRNA linear PLN 14-SEP-2017 DEFINITION Eremothecium gossypii ATCC 10895 40S ribosomal protein S23 (AGOS_AAR108C), partial mRNA. ACCESSION NM_208002 VERSION NM_208002.1 DBLINK BioProject: PRJNA10623 BioSample: SAMN03081415 KEYWORDS RefSeq. SOURCE Eremothecium gossypii ATCC 10895 (Ashbya gossypii ATCC 10895) ORGANISM Eremothecium gossypii ATCC 10895 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Eremothecium. REFERENCE 1 (bases 1 to 438) AUTHORS Dietrich,F.S., Voegeli,S., Brachat,S., Lerch,A., Gates,K., Steiner,S., Mohr,C., Pohlmann,R., Luedi,P., Choi,S., Wing,R.A., Flavier,A., Gaffney,T.D. and Philippsen,P. TITLE The Ashbya gossypii genome as a tool for mapping the ancient Saccharomyces cerevisiae genome JOURNAL Science 304 (5668), 304-307 (2004) PUBMED 15001715 REFERENCE 2 (bases 1 to 438) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (13-SEP-2017) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 438) AUTHORS Dietrich,F.S., Voegeli,S. and Philippsen,P. TITLE Direct Submission JOURNAL Submitted (03-JUN-2010) Biozentrum, Klingelbergstrasse 50, Basel CH-4056, Switzerland REMARK Sequence update by submitter REFERENCE 4 (bases 1 to 438) AUTHORS Lerch,A., Brachat,S., Voegeli,S.E., Gaffney,T., Philippsen,P. and Dietrich,F.S. TITLE Direct Submission JOURNAL Submitted (09-AUG-2007) Biozentrum, Klingelbergstrasse 50, Basel CH-4056, Switzerland REMARK Sequence update by submitter REFERENCE 5 (bases 1 to 438) AUTHORS Lerch,A., Brachat,S., Voegeli,S.E., Gaffney,T., Philippsen,P. and Dietrich,F.S. TITLE Direct Submission JOURNAL Submitted (20-DEC-2002) Biozentrum, Klingelbergstrasse 50, Basel CH-4056, Switzerland COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_005782). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..438 /organism="Eremothecium gossypii ATCC 10895" /mol_type="mRNA" /strain="ATCC 10895" /culture_collection="ATCC:10895" /db_xref="taxon:284811" /chromosome="I" gene <1..>438 /locus_tag="AGOS_AAR108C" /old_locus_tag="AAR108C" /db_xref="GeneID:4618617" CDS 1..438 /locus_tag="AGOS_AAR108C" /old_locus_tag="AAR108C" /note="Syntenic homolog of Saccharomyces cerevisiae YPR132W (RPS23B) and YGR118W (RPS23A); 1-intron" /codon_start=1 /product="40S ribosomal protein S23" /protein_id="NP_982649.1" /db_xref="GeneID:4618617" /translation="
MGKGKPRGLNSARKLRVHRRNNRWAEQTYKKRLLGTAFKSSPFGGSSHAKGIVLEKIGVESKQPNSAIRKCVRVQLIKNGKKVTAFVPNDGCLNFVDENDEVLLAGFGRKGKAKGDIPGVRFKVVKVSGVSLLALWKEKKEKPRS"
misc_feature 10..435 /locus_tag="AGOS_AAR108C" /old_locus_tag="AAR108C" /note="40S ribosomal S23; Provisional; Region: PTZ00067" /db_xref="CDD:185422" misc_feature order(88..102,106..108,112..129,133..153,184..210, 226..234,256..258,262..273,310..330,337..348,364..369, 382..384,388..390,418..426) /locus_tag="AGOS_AAR108C" /note="18S rRNA interaction site [nucleotide binding]; other site" /db_xref="CDD:239465" misc_feature order(184..189,340..342) /locus_tag="AGOS_AAR108C" /note="streptomycin interaction site [chemical binding]; other site" /db_xref="CDD:239465" misc_feature 187..192 /locus_tag="AGOS_AAR108C" /note="28S rRNA interaction site [nucleotide binding]; other site" /db_xref="CDD:239465" misc_feature order(190..207,268..294) /locus_tag="AGOS_AAR108C" /note="aminoacyl-tRNA interaction site (A-site) [nucleotide binding]; other site" /db_xref="CDD:239465" misc_feature 295..297 /locus_tag="AGOS_AAR108C" /note="eEF2 interaction site [polypeptide binding]; other site" /db_xref="CDD:239465" ORIGIN
atgggtaagggtaagccaagaggtttgaactccgctagaaagttgcgtgtccacagaagaaacaaccgttgggccgaacaaacctacaagaagagattgctaggtactgccttcaagtcttctccattcggtggttcttctcacgcaaagggtattgtgttggaaaagattggtgtcgagtccaagcagccaaactccgctatcagaaagtgtgtcagagtgcaattgattaagaacggtaagaaggttactgctttcgttcctaacgacggttgtttgaacttcgtcgacgagaacgacgaggtcttgttggctggtttcggtagaaagggtaaggccaagggtgatattccaggtgtcagattcaaggtcgtgaaggtgtctggtgtttccttgttggccttgtggaaggagaagaaggagaagccaagatcctaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]