GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-26 07:32:34, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_208002                438 bp    mRNA    linear   PLN 14-SEP-2017
DEFINITION  Eremothecium gossypii ATCC 10895 40S ribosomal protein S23
            (AGOS_AAR108C), partial mRNA.
ACCESSION   NM_208002
VERSION     NM_208002.1
DBLINK      BioProject: PRJNA10623
            BioSample: SAMN03081415
KEYWORDS    RefSeq.
SOURCE      Eremothecium gossypii ATCC 10895 (Ashbya gossypii ATCC 10895)
  ORGANISM  Eremothecium gossypii ATCC 10895
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Eremothecium.
REFERENCE   1  (bases 1 to 438)
  AUTHORS   Dietrich,F.S., Voegeli,S., Brachat,S., Lerch,A., Gates,K.,
            Steiner,S., Mohr,C., Pohlmann,R., Luedi,P., Choi,S., Wing,R.A.,
            Flavier,A., Gaffney,T.D. and Philippsen,P.
  TITLE     The Ashbya gossypii genome as a tool for mapping the ancient
            Saccharomyces cerevisiae genome
  JOURNAL   Science 304 (5668), 304-307 (2004)
   PUBMED   15001715
REFERENCE   2  (bases 1 to 438)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (13-SEP-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 438)
  AUTHORS   Dietrich,F.S., Voegeli,S. and Philippsen,P.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-JUN-2010) Biozentrum, Klingelbergstrasse 50, Basel
            CH-4056, Switzerland
  REMARK    Sequence update by submitter
REFERENCE   4  (bases 1 to 438)
  AUTHORS   Lerch,A., Brachat,S., Voegeli,S.E., Gaffney,T., Philippsen,P. and
            Dietrich,F.S.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-AUG-2007) Biozentrum, Klingelbergstrasse 50, Basel
            CH-4056, Switzerland
  REMARK    Sequence update by submitter
REFERENCE   5  (bases 1 to 438)
  AUTHORS   Lerch,A., Brachat,S., Voegeli,S.E., Gaffney,T., Philippsen,P. and
            Dietrich,F.S.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-DEC-2002) Biozentrum, Klingelbergstrasse 50, Basel
            CH-4056, Switzerland
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_005782).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..438
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="mRNA"
                     /strain="ATCC 10895"
                     /culture_collection="ATCC:10895"
                     /db_xref="taxon:284811"
                     /chromosome="I"
     gene            <1..>438
                     /locus_tag="AGOS_AAR108C"
                     /old_locus_tag="AAR108C"
                     /db_xref="GeneID:4618617"
     CDS             1..438
                     /locus_tag="AGOS_AAR108C"
                     /old_locus_tag="AAR108C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR132W (RPS23B) and YGR118W (RPS23A); 1-intron"
                     /codon_start=1
                     /product="40S ribosomal protein S23"
                     /protein_id="NP_982649.1"
                     /db_xref="GeneID:4618617"
                     /translation="
MGKGKPRGLNSARKLRVHRRNNRWAEQTYKKRLLGTAFKSSPFGGSSHAKGIVLEKIGVESKQPNSAIRKCVRVQLIKNGKKVTAFVPNDGCLNFVDENDEVLLAGFGRKGKAKGDIPGVRFKVVKVSGVSLLALWKEKKEKPRS"
     misc_feature    10..435
                     /locus_tag="AGOS_AAR108C"
                     /old_locus_tag="AAR108C"
                     /note="40S ribosomal S23; Provisional; Region: PTZ00067"
                     /db_xref="CDD:185422"
     misc_feature    order(88..102,106..108,112..129,133..153,184..210,
                     226..234,256..258,262..273,310..330,337..348,364..369,
                     382..384,388..390,418..426)
                     /locus_tag="AGOS_AAR108C"
                     /note="18S rRNA interaction site [nucleotide binding];
                     other site"
                     /db_xref="CDD:239465"
     misc_feature    order(184..189,340..342)
                     /locus_tag="AGOS_AAR108C"
                     /note="streptomycin interaction site [chemical binding];
                     other site"
                     /db_xref="CDD:239465"
     misc_feature    187..192
                     /locus_tag="AGOS_AAR108C"
                     /note="28S rRNA interaction site [nucleotide binding];
                     other site"
                     /db_xref="CDD:239465"
     misc_feature    order(190..207,268..294)
                     /locus_tag="AGOS_AAR108C"
                     /note="aminoacyl-tRNA interaction site (A-site)
                     [nucleotide binding]; other site"
                     /db_xref="CDD:239465"
     misc_feature    295..297
                     /locus_tag="AGOS_AAR108C"
                     /note="eEF2 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:239465"
ORIGIN      
atgggtaagggtaagccaagaggtttgaactccgctagaaagttgcgtgtccacagaagaaacaaccgttgggccgaacaaacctacaagaagagattgctaggtactgccttcaagtcttctccattcggtggttcttctcacgcaaagggtattgtgttggaaaagattggtgtcgagtccaagcagccaaactccgctatcagaaagtgtgtcagagtgcaattgattaagaacggtaagaaggttactgctttcgttcctaacgacggttgtttgaacttcgtcgacgagaacgacgaggtcttgttggctggtttcggtagaaagggtaaggccaagggtgatattccaggtgtcagattcaaggtcgtgaaggtgtctggtgtttccttgttggccttgtggaaggagaagaaggagaagccaagatcctaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]