GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2019-03-23 04:05:02, GGRNA.v2 : RefSeq release 92 (Jan, 2019)

LOCUS       NM_207177               1263 bp    mRNA    linear   VRT 09-DEC-2018
DEFINITION  Gallus gallus homeobox D8 (HOXD8), mRNA.
ACCESSION   NM_207177
VERSION     NM_207177.1
KEYWORDS    RefSeq.
SOURCE      Gallus gallus (chicken)
  ORGANISM  Gallus gallus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
            Phasianidae; Phasianinae; Gallus.
REFERENCE   1  (bases 1 to 1263)
  AUTHORS   Crompton MR, MacGregor AD and Goodwin GH.
  TITLE     cDNA cloning of a homeobox-containing gene expressed in avian
            myeloblastic virus-transformed chicken monoblastic leukaemia cells
  JOURNAL   Leukemia 5 (5), 357-360 (1991)
   PUBMED   1674560
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from X57158.1.
            
            ##Evidence-Data-START##
            CDS exon combination :: X57158.1 [ECO:0000331]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1263
                     /organism="Gallus gallus"
                     /mol_type="mRNA"
                     /db_xref="taxon:9031"
                     /chromosome="7"
                     /map="7"
     gene            1..1263
                     /gene="HOXD8"
                     /note="homeobox D8"
                     /db_xref="CGNC:49743"
                     /db_xref="GeneID:396301"
     CDS             166..732
                     /gene="HOXD8"
                     /note="CHOX M product; homeo box D8; chox-M; homeobox
                     protein Hox-M"
                     /codon_start=1
                     /product="homeobox protein Hox-D8"
                     /protein_id="NP_997060.1"
                     /db_xref="CGNC:49743"
                     /db_xref="GeneID:396301"
                     /translation="
MSSYFVNPLYSKYKAAAAAAAAVAAGEPLPAPYYDCHFAPERQQIFTTQQEAELVQYPDCKSSSANIGEEPDHLNQSSSPAQMFPWMRPQAAPGRRRGRQTYSRFQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKFPASKQEGKEGEAKKETHDLEDDRAESHTN"
     misc_feature    412..429
                     /gene="HOXD8"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P23459.1);
                     Region: Antp-type hexapeptide"
     misc_feature    order(451..465,469..471,520..522,538..540,577..579,
                     583..588,595..600,604..612,616..621)
                     /gene="HOXD8"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(457..459,466..468,586..588,595..600,607..609)
                     /gene="HOXD8"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    460..618
                     /gene="HOXD8"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:278475"
ORIGIN      
gggcgattatattccagccccggtcaccgcgcacacggagagcaggagaggggagcgcacggggcgcggcggcggcggcaccgggagagcagcggagaggcaccggcggcggcaccgggagcagcgccccgcgcccgctccccgcccgccgctgccccctccccgatgagctcctactttgtcaacccgctctactccaagtacaaggcggcggctgcggctgcggcggcggtggcggcgggggagcctctgcccgccccgtactacgactgtcacttcgcgcccgagagacagcagatttttacgacacagcaagaggccgagctggtacaatatcctgactgtaaatcgtccagtgctaatattggcgaggaaccagaccacttaaatcagagctcgtctcccgctcaaatgtttccctggatgagaccgcaagcagcgcccgggaggaggagagggcggcagacgtacagccgcttccagacgctggagctggagaaggagtttctctttaacccctatctgaccaggaagagacgaatcgaggtgtcccacgccctaggactcaccgagcggcaggtaaagatctggtttcagaacaggaggatgaagtggaaaaaggagaacaacaaggacaaattccccgcttccaagcaggagggaaaggaaggggaggccaaaaaggaaacacatgatctggaagacgacagagccgaaagccacacgaattaaattaattttgccctaaaagcctttgtgaagggccatcgggaacgaggagcccacggccgcagctccgggcccgtccccgccgtgtgcgtcccgcggggccgcgtcccgccccactccgcgccgtgtgggttcgggtttgggtccaactgcatccggagcgatctccagatgtccgctcgtccgctcctcctggaaatctgatagcgagttcgcagcaatacatttctaatgagatatatatatatatatatataaacagatactatttttttttttgcaatattgaaagacggtgattgcgacgtacacttcctaatgacaagcgccaataagcgagacatgtaccaatgctttattaatcaaacaagtgcacttgtactattttatttcttgttattttctaatctcgaataaattaaggaaatttaataaattttgaagagcagatcttagaaatatatcaaactttctactatcgatatttgatttaaataaatcataattattcaaatataaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]