LOCUS       NM_205488               1326 bp    mRNA    linear   VRT 23-SEP-2023
DEFINITION  Gallus gallus msh homeobox 1 (MSX1), mRNA.
ACCESSION   NM_205488 XM_444660
VERSION     NM_205488.3
KEYWORDS    RefSeq.
SOURCE      Gallus gallus (chicken)
  ORGANISM  Gallus gallus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
            Phasianidae; Phasianinae; Gallus.
REFERENCE   1  (bases 1 to 1326)
  AUTHORS   Yamagishi T, Narematsu M and Nakajima Y.
  TITLE     Msx1 upregulates p27 expression to control cellular proliferation
            during valvuloseptal endocardial cushion formation in the chick
            embryonic heart
  JOURNAL   Anat Rec (Hoboken) 304 (8), 1732-1744 (2021)
   PUBMED   33191650
  REMARK    GeneRIF: Msx1 upregulates p27 expression to control cellular
            proliferation during valvuloseptal endocardial cushion formation in
            the chick embryonic heart.
REFERENCE   2  (bases 1 to 1326)
  AUTHORS   Tang H, Finn RD and Thomas PD.
  TITLE     TreeGrafter: phylogenetic tree-based annotation of proteins with
            Gene Ontology terms and other annotations
  JOURNAL   Bioinformatics 35 (3), 518-520 (2019)
   PUBMED   30032202
REFERENCE   3  (bases 1 to 1326)
  AUTHORS   Burge S, Kelly E, Lonsdale D, Mutowo-Muellenet P, McAnulla C,
            Mitchell A, Sangrador-Vegas A, Yong SY, Mulder N and Hunter S.
  TITLE     Manual GO annotation of predictive protein signatures: the InterPro
            approach to GO curation
  JOURNAL   Database (Oxford) 2012, bar068 (2012)
   PUBMED   22301074
  REMARK    Publication Status: Online-Only
REFERENCE   4  (bases 1 to 1326)
  AUTHORS   Misra K and Matise MP.
  TITLE     A critical role for sFRP proteins in maintaining caudal neural tube
            closure in mice via inhibition of BMP signaling
  JOURNAL   Dev Biol 337 (1), 74-83 (2010)
   PUBMED   19850029
REFERENCE   5  (bases 1 to 1326)
  AUTHORS   Kuraku S, Usuda R and Kuratani S.
  TITLE     Comprehensive survey of carapacial ridge-specific genes in turtle
            implies co-option of some regulatory genes in carapace evolution
  JOURNAL   Evol Dev 7 (1), 3-17 (2005)
   PUBMED   15642085
REFERENCE   6  (bases 1 to 1326)
  AUTHORS   Coelho CN, Sumoy L, Kosher RA and Upholt WB.
  TITLE     GHox-7: a chicken homeobox-containing gene expressed in a fashion
            consistent with a role in patterning events during embryonic chick
            limb development
  JOURNAL   Differentiation 49 (2), 85-92 (1992)
   PUBMED   1350765
REFERENCE   7  (bases 1 to 1326)
  AUTHORS   Nohno T, Noji S, Koyama E, Nishikawa K, Myokai F, Saito T and
            Taniguchi S.
  TITLE     Differential expression of two msh-related homeobox genes Chox-7
            and Chox-8 during chick limb development
  JOURNAL   Biochem Biophys Res Commun 182 (1), 121-128 (1992)
   PUBMED   1346246
REFERENCE   8  (bases 1 to 1326)
  AUTHORS   Robert B, Lyons G, Simandl BK, Kuroiwa A and Buckingham M.
  TITLE     The apical ectodermal ridge regulates Hox-7 and Hox-8 gene
            expression in developing chick limb buds
  JOURNAL   Genes Dev 5 (12B), 2363-2374 (1991)
   PUBMED   1684333
REFERENCE   9  (bases 1 to 1326)
  AUTHORS   Suzuki HR, Padanilam BJ, Vitale E, Ramirez F and Solursh M.
  TITLE     Repeating developmental expression of G-Hox 7, a novel
            homeobox-containing gene in the chicken
  JOURNAL   Dev Biol 148 (1), 375-388 (1991)
   PUBMED   1682191
  REMARK    Erratum:[Dev Biol. 1992 Apr;150(2):427. PMID: 1348039]
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            JAENSK010000074.1.
            
            On Sep 23, 2021 this sequence version replaced NM_205488.2.
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.
            
            ##Evidence-Data-START##
            Transcript exon combination :: D10372.1, SRR13267654.237058.1
                                           [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA103992290, SAMEA103992393
                                           [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-528               JAENSK010000074.1  31366248-31366775
            529-1326            JAENSK010000074.1  31367955-31368752
FEATURES             Location/Qualifiers
     source          1..1326
                     /organism="Gallus gallus"
                     /mol_type="mRNA"
                     /db_xref="taxon:9031"
                     /chromosome="4"
                     /map="4"
     gene            1..1326
                     /gene="MSX1"
                     /gene_synonym="CHOX-7; GHOX-7; HOX-7"
                     /note="msh homeobox 1"
                     /db_xref="CGNC:11159"
                     /db_xref="GeneID:396484"
     exon            1..528
                     /gene="MSX1"
                     /gene_synonym="CHOX-7; GHOX-7; HOX-7"
                     /inference="alignment:Splign:2.1.0"
     CDS             93..959
                     /gene="MSX1"
                     /gene_synonym="CHOX-7; GHOX-7; HOX-7"
                     /note="homeobox protein GHOX-7; Hbox 7; homeobox protein
                     Hox-7; msh homeobox 1-like protein; msh homeobox homolog
                     1; msh homeo box homolog 1"
                     /codon_start=1
                     /product="homeobox protein MSX-1"
                     /protein_id="NP_990819.1"
                     /db_xref="CGNC:11159"
                     /db_xref="GeneID:396484"
                     /translation="

MAPAADMTTAPTGVRSDEPPASAFSKPGGGLPVAAAMGGEEESDKPKVSPSPLPFSVEALMADRRKPPGGRDGPEGSGPPLGSARANLGALTTEAPTSPLPLGGHFPSVGALGKLPEDALLKAESPEKPERSPWMQSPRFSPPPPRRLSPPACTLRKHKTNRKPRTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPMLPPAAFGISFPLGGPAVAGASLYGASSPFQRAGLPVAPVGLYTAHVGYSMYHLT"

     misc_feature    93..425
                     /gene="MSX1"
                     /gene_synonym="CHOX-7; GHOX-7; HOX-7"
                     /note="propagated from UniProtKB/Swiss-Prot (P50223.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    459..548
                     /gene="MSX1"
                     /gene_synonym="CHOX-7; GHOX-7; HOX-7"
                     /note="propagated from UniProtKB/Swiss-Prot (P50223.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    order(576..590,594..596,645..647,663..665,702..704,
                     708..713,720..725,729..737,741..746)
                     /gene="MSX1"
                     /gene_synonym="CHOX-7; GHOX-7; HOX-7"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    582..743
                     /gene="MSX1"
                     /gene_synonym="CHOX-7; GHOX-7; HOX-7"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
     misc_feature    order(582..584,591..593,711..713,720..725,732..734)
                     /gene="MSX1"
                     /gene_synonym="CHOX-7; GHOX-7; HOX-7"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     exon            529..1326
                     /gene="MSX1"
                     /gene_synonym="CHOX-7; GHOX-7; HOX-7"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

ggaccgcgccgacggctcccgcgcctccgccgcgccctcatgagccgcggccgccgctcccgcggagcacggcgacagcggggccgccctgcatggccccggctgcggacatgaccaccgcgcccaccggcgtccgcagcgacgagccgcccgcctccgccttcagcaagcccggcggcggcctccccgtcgcggcggcgatgggcggcgaggaggagagcgacaaacccaaggtgtccccttccccgctgcccttcagcgtggaagcgctcatggccgaccgcaggaagccgccgggcggcagagacggtcccgagggttccgggccccctctgggctccgcccgagccaacctcggcgctctgacgacggaggcaccgacgtcgccgctgcctctcggcggccacttcccgtccgtcggggcgctgggcaagctgcccgaggacgcgctgctcaaagcagagagccccgagaagccggagcggagcccctggatgcagagcccccgcttctcgccgcccccgcccaggcggctgagcccccccgcctgcaccctgcgcaagcacaagaccaacaggaagccccggacgcccttcaccacggcccagctgctggccctggagaggaaattccgccagaagcagtacctgtccatcgccgagcgcgccgagttctccagctcgctcagcctcaccgagacgcaggtgaagatctggttccagaaccgccgtgccaaggccaagcggctgcaggaggccgagctggagaagctgaagatggcagccaagcccatgctcccgcctgctgcattcggcatctccttcccgttgggcggcccagcagtggccggcgcatccctgtacggagcctccagccccttccagcgagcggggctgcccgtggcccctgtgggactgtacacggcgcacgtgggatatagtatgtaccaccttacatagggccgagccgcccgtgcgggcccccggcagagacttctccgctcccttcatccagaccttcaaccctgggatctgttctgtgcctggcaggaaggaacccgtggtgcggccttgctggcacctggggaaggaactgtggcagagaaagggcacaaaggcagcccagtaggacatttctgcaaggcgagggtgggaggcagagccgcctgtcccgtccctgcagggcagctgttaacctgtggccattcctccgccagctcctgaggaaggggctctctctgtgtactatgtaatatactgtatatttgaaattttattatcatttatattatagctatatttgttaaataaattaattttaagctac

//