GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2020-04-06 12:20:42, GGRNA.v2 : RefSeq release 99 (Mar, 2020)

LOCUS       NM_204620               1006 bp    mRNA    linear   VRT 27-DEC-2019
DEFINITION  Gallus gallus homeobox D11 (HOXD11), mRNA.
ACCESSION   NM_204620 XM_001234561
VERSION     NM_204620.1
KEYWORDS    RefSeq.
SOURCE      Gallus gallus (chicken)
  ORGANISM  Gallus gallus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
            Phasianidae; Phasianinae; Gallus.
REFERENCE   1  (bases 1 to 1006)
  AUTHORS   Kamiyama N, Seki R, Yokoyama H and Tamura K.
  TITLE     Heterochronically early decline of Hox expression prior to
            cartilage formation in the avian hindlimb zeugopod
  JOURNAL   Dev. Growth Differ. 54 (6), 619-632 (2012)
   PUBMED   22708793
  REMARK    GeneRIF: Expression of Hoxd11/Hoxd12 in the chick hindlimb
            decreased and disappeared from the presumptive zeugopod region
            before cartilage formation.
REFERENCE   2  (bases 1 to 1006)
  AUTHORS   Rogina B, Coelho CN, Kosher RA and Upholt WB.
  TITLE     The pattern of expression of the chicken homolog of HOX1I in the
            developing limb suggests a possible role in the ectodermal
            inhibition of chondrogenesis
  JOURNAL   Dev. Dyn. 193 (1), 92-101 (1992)
   PUBMED   1347239
REFERENCE   3  (bases 1 to 1006)
  AUTHORS   Izpisua-Belmonte JC, Tickle C, Dolle P, Wolpert L and Duboule D.
  TITLE     Expression of the homeobox Hox-4 genes and the specification of
            position in chick wing development
  JOURNAL   Nature 350 (6319), 585-589 (1991)
   PUBMED   1673231
REFERENCE   4  (bases 1 to 1006)
  AUTHORS   Nohno T, Noji S, Koyama E, Ohyama K, Myokai F, Kuroiwa A, Saito T
            and Taniguchi S.
  TITLE     Involvement of the Chox-4 chicken homeobox genes in determination
            of anteroposterior axial polarity during limb development
  JOURNAL   Cell 64 (6), 1197-1205 (1991)
   PUBMED   1672266
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from M81249.1.
            On Dec 9, 2006 this sequence version replaced XM_001234561.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: M81249.1, JF317542.1 [ECO:0000332]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1006
                     /organism="Gallus gallus"
                     /mol_type="mRNA"
                     /db_xref="taxon:9031"
                     /chromosome="7"
                     /map="7"
     gene            1..1006
                     /gene="HOXD11"
                     /gene_synonym="GHOX4.6"
                     /note="homeobox D11"
                     /db_xref="CGNC:7045"
                     /db_xref="GeneID:395328"
     exon            1..685
                     /gene="HOXD11"
                     /gene_synonym="GHOX4.6"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    40..42
                     /gene="HOXD11"
                     /gene_synonym="GHOX4.6"
                     /note="upstream in-frame stop codon"
     CDS             79..921
                     /gene="HOXD11"
                     /gene_synonym="GHOX4.6"
                     /note="homeodomain-containing protein; homeo box D11;
                     chox-4E; chox-4.6; ghox-4.6; homeobox protein Hox-4E;
                     homeobox protein Hox-4.6; Hox D11"
                     /codon_start=1
                     /product="homeobox protein Hox-D11"
                     /protein_id="NP_989951.1"
                     /db_xref="CGNC:7045"
                     /db_xref="GeneID:395328"
                     /translation="
MTEFDDCSHGASNMYLPGCAYYVSPSDFSTKPSFLSQSSSCQMTFPYSSNLPHVQPVREVAFREYGLERGKWQYRGSYAPYYSAEEVMHRDFLQPANRRTEMLFKTDPVCGHHGASPAASNFYGSVGRNGILPQGFDQFYEPAPAPPYQQHSEGEGDADKGELKPQHSACSKAPSGQEKKVTTASGAASPPGEAVAEKSNSSAVPQRSRKKRCPYTKYQIRELEREFFFNVYINKEKRLQLSRMLNLTDRQVKIWFQNRRMKEKKLNRDRLQYFTGNPLF"
     misc_feature    154..561
                     /gene="HOXD11"
                     /gene_synonym="GHOX4.6"
                     /note="Protein of unknown function (DUF3528); Region:
                     DUF3528; pfam12045"
                     /db_xref="CDD:288866"
     misc_feature    order(703..717,721..723,772..774,790..792,829..831,
                     835..840,847..852,856..864,868..873)
                     /gene="HOXD11"
                     /gene_synonym="GHOX4.6"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    709..870
                     /gene="HOXD11"
                     /gene_synonym="GHOX4.6"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:278475"
     misc_feature    order(709..711,718..720,838..840,847..852,859..861)
                     /gene="HOXD11"
                     /gene_synonym="GHOX4.6"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     exon            686..992
                     /gene="HOXD11"
                     /gene_synonym="GHOX4.6"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
aaagcctcttgtgcaatagatggatctcgttcaacgcattgaagcctcccggtcgctcgcaatcgcgaaaaggaagacatgaccgagtttgacgattgcagtcacggcgcatccaatatgtatctgccagggtgcgcttattacgtctcgccctcagacttctcgacgaaaccctcttttttgtcgcaatcgtcttcctgtcaaatgacttttccttattcttctaatttacctcatgtccaacctgtgcgcgaagtggcattcagggaatacggattagagcgcggcaaatggcagtacaggggcagttacgctccctattactcagctgaagaggtgatgcacagagactttctgcagcccgcgaacaggaggacggaaatgctattcaaaacggaccccgtgtgcggccaccacggagcgtcccccgccgcctccaacttctacggctcggtggggaggaacggcatcctgccgcagggcttcgaccagttctacgagccggcccccgcgcccccgtaccagcagcactccgagggcgagggggacgcggacaagggcgagctgaagccccagcacagcgcctgcagcaaggcaccttccggccaggagaagaaagtgacaacggcgagcggcgccgcttcccctcccggtgaggctgttgcagagaagagcaacagttcagcagttcctcagcgatcgaggaaaaagaggtgtccctataccaaatatcagataagagaactggaacgtgagtttttcttcaacgtgtacataaacaaagagaaaagactgcagttgtccagaatgctcaacctcactgaccggcaagttaaaatctggttccagaatcgaaggatgaaagaaaagaaactgaacagagatcgactccaatacttcactggaaatcccttgttttgaggaggaaaaaaagaaagaaaaaaaaaagaaaggaaaaaaaaaaaagaaaggaaaaaatgtaaaaaaaaaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]