GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2020-11-27 02:32:05, GGRNA.v2 : RefSeq release 202 (Sep, 2020)

LOCUS       NM_204614               1453 bp    mRNA    linear   VRT 25-JUN-2020
DEFINITION  Gallus gallus caudal type homeobox 4 (CDX4), mRNA.
ACCESSION   NM_204614
VERSION     NM_204614.1
KEYWORDS    RefSeq.
SOURCE      Gallus gallus (chicken)
  ORGANISM  Gallus gallus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
            Phasianidae; Phasianinae; Gallus.
REFERENCE   1  (bases 1 to 1453)
  AUTHORS   Joshi P, Darr AJ and Skromne I.
  TITLE     CDX4 regulates the progression of neural maturation in the spinal
            cord
  JOURNAL   Dev. Biol. 449 (2), 132-142 (2019)
   PUBMED   30825428
  REMARK    GeneRIF: Results show that in the spinal cord, caudal type homeobox
            4 (CDX4) is part of the gene regulatory network controlling the
            sequential and progressive transition of states from high to low
            potency during neural progenitor maturation.
REFERENCE   2  (bases 1 to 1453)
  AUTHORS   Ehrman LA and Yutzey KE.
  TITLE     Anterior expression of the caudal homologue cCdx-B activates a
            posterior genetic program in avian embryos
  JOURNAL   Dev. Dyn. 221 (4), 412-421 (2001)
   PUBMED   11500978
REFERENCE   3  (bases 1 to 1453)
  AUTHORS   Serrano J, Scavo L, Roth J, de la Rosa EJ and de Pablo F.
  TITLE     A novel chicken homeobox-containing gene expressed in neurulating
            embryos
  JOURNAL   Biochem. Biophys. Res. Commun. 190 (1), 270-276 (1993)
   PUBMED   7678491
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AF353624.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AF353624.1, BU272240.1 [ECO:0000332]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1453
                     /organism="Gallus gallus"
                     /mol_type="mRNA"
                     /db_xref="taxon:9031"
                     /chromosome="4"
                     /map="4"
     gene            1..1453
                     /gene="CDX4"
                     /gene_synonym="cCdx-B; CDXB; CHOX-CAD2; ox-cad2"
                     /note="caudal type homeobox 4"
                     /db_xref="CGNC:49264"
                     /db_xref="GeneID:395320"
     exon            1..523
                     /gene="CDX4"
                     /gene_synonym="cCdx-B; CDXB; CHOX-CAD2; ox-cad2"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    58..60
                     /gene="CDX4"
                     /gene_synonym="cCdx-B; CDXB; CHOX-CAD2; ox-cad2"
                     /note="upstream in-frame stop codon"
     CDS             85..876
                     /gene="CDX4"
                     /gene_synonym="cCdx-B; CDXB; CHOX-CAD2; ox-cad2"
                     /note="caudal-type homeobox protein CDXB; caudal type
                     homeo box transcription factor 4; caudal type homeobox
                     transcription factor 4"
                     /codon_start=1
                     /product="homeobox protein CHOX-CAD2"
                     /protein_id="NP_989945.1"
                     /db_xref="CGNC:49264"
                     /db_xref="GeneID:395320"
                     /translation="
MYVSSLLDKETSMYPGPARCSNNNLPVQNFVPAPPYSDYMGYHHVPAPDSHGQPAGAWGPHYGPQREDWNAYGPCPGPSGTAAAAQLSGSSPGQGSYSPAEYSSLHPAAPGGLPPAGTVGTQQVSPTNQRHSSYEWMRKTVPTNTTGKTRTKEKYRVVYTDHQRLELEKEFHCNRYITIRRKSELAANLGLSERQVKIWFQNRRAKERKIIKKKISQFDGSGGSVQSDSGSLSPNEITSSLFPPPHGINVLQSADIHQVIVSE"
     misc_feature    121..501
                     /gene="CDX4"
                     /gene_synonym="cCdx-B; CDXB; CHOX-CAD2; ox-cad2"
                     /note="Caudal like protein activation region; Region:
                     Caudal_act; pfam04731"
                     /db_xref="CDD:282574"
     misc_feature    order(544..555,559..561,610..612,628..630,667..669,
                     673..678,685..690,694..702,706..708)
                     /gene="CDX4"
                     /gene_synonym="cCdx-B; CDXB; CHOX-CAD2; ox-cad2"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(547..549,556..558,676..678,685..690,697..699)
                     /gene="CDX4"
                     /gene_synonym="cCdx-B; CDXB; CHOX-CAD2; ox-cad2"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    550..708
                     /gene="CDX4"
                     /gene_synonym="cCdx-B; CDXB; CHOX-CAD2; ox-cad2"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:278475"
     exon            524..669
                     /gene="CDX4"
                     /gene_synonym="cCdx-B; CDXB; CHOX-CAD2; ox-cad2"
                     /inference="alignment:Splign:2.1.0"
     exon            670..1445
                     /gene="CDX4"
                     /gene_synonym="cCdx-B; CDXB; CHOX-CAD2; ox-cad2"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
aaaatcaagctactattttttaagcagcaaaagaaaatacagaagagcaagatgttgtgacaacatttacaatctgcaagcatcatgtatgtgagttctctcttggataaagagaccagcatgtatccaggacctgcaaggtgcagcaacaacaacctgccagtgcagaactttgtgcctgctcccccctactcagactacatggggtatcaccacgtgccagctccagacagccacggacagcccgcgggagcctggggaccccactacggcccccagagggaggactggaacgcttacggcccgtgcccagggccctccggcacggctgctgccgcacagctcagcggctcctctcctgggcagggctcctacagtccagctgagtacagctccctccatcccgctgcacccggggggttacctcctgcaggcaccgttggcacacagcaggtctcacccaccaaccaaaggcacagctcttacgaatggatgaggaaaacggtgccaactaacactactggtaaaacaagaacaaaagagaagtaccgggttgtttacacagaccatcagagactagaattagagaaggaatttcactgcaacagatacattacaataaggagaaagtcagaacttgcagcaaaccttggactatctgaaagacaggtaaaaatctggttccagaatcgccgagccaaagaaagaaaaataatcaagaagaaaatctctcagtttgatggcagcgggggctcagttcagagtgactctggttcactcagccctaatgaaataacaagttccctgttcccaccaccacacggaataaatgtattacagtctgctgacatccatcaggtcatagtttcagaatgaacagtgggggaaaaagaaaaacagaaaaaaagagttgtatggattttttgtttttgtttttaactccctctattgaaaactcaattttgcaaagcaccattcttgtttaactaccttcagagtacttatttccacatagaggatctggaactattaccaaaatatttcaattaaaaaaatctcagggagttcgtgctgctgctaatactcatcactcaaaatcttttgaatagaagataatttacttcagataccgaagcagaaaaagatactgctgaagattcaagcaaacctaattctagtctgctcatgtatacaaagaaaactgtcagtgaattgattatagagtaatactgcataaaatgtaagatgctggatgtatttagtttgttacattttatataattaaacagtagattttataaatattcacatttaatgtgtactgaaaattaagtcattttttgaaaacaactttttaaacacttaaacactcaagagacataacaatgttacgcctggtgacacattgcgtcccattaaataaaatgaatagtctttgtattctaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]