GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2019-03-22 05:18:55, GGRNA.v2 : RefSeq release 92 (Jan, 2019)

LOCUS       NM_204559               1107 bp    mRNA    linear   VRT 23-JUN-2018
DEFINITION  Gallus gallus msh homeobox 2 (MSX2), mRNA.
ACCESSION   NM_204559
VERSION     NM_204559.1
KEYWORDS    RefSeq.
SOURCE      Gallus gallus (chicken)
  ORGANISM  Gallus gallus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
            Phasianidae; Phasianinae; Gallus.
REFERENCE   1  (bases 1 to 1107)
  AUTHORS   Sumoy L, Wang CK, Lichtler AC, Pierro LJ, Kosher RA and Upholt WB.
  TITLE     Identification of a spatially specific enhancer element in the
            chicken Msx-2 gene that regulates its expression in the apical
            ectodermal ridge of the developing limb buds of transgenic mice
  JOURNAL   Dev. Biol. 170 (1), 230-242 (1995)
   PUBMED   7601312
REFERENCE   2  (bases 1 to 1107)
  AUTHORS   Robert B, Lyons G, Simandl BK, Kuroiwa A and Buckingham M.
  TITLE     The apical ectodermal ridge regulates Hox-7 and Hox-8 gene
            expression in developing chick limb buds
  JOURNAL   Genes Dev. 5 (12B), 2363-2374 (1991)
   PUBMED   1684333
REFERENCE   3  (bases 1 to 1107)
  AUTHORS   Yokouchi Y, Ohsugi K, Sasaki H and Kuroiwa A.
  TITLE     Chicken homeobox gene Msx-1: structure, expression in limb buds and
            effect of retinoic acid
  JOURNAL   Development 113 (2), 431-444 (1991)
   PUBMED   1685987
REFERENCE   4  (bases 1 to 1107)
  AUTHORS   Coelho CN, Sumoy L, Rodgers BJ, Davidson DR, Hill RE, Upholt WB and
            Kosher RA.
  TITLE     Expression of the chicken homeobox-containing gene GHox-8 during
            embryonic chick limb development
  JOURNAL   Mech. Dev. 34 (2-3), 143-154 (1991)
   PUBMED   1680378
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from S64478.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: S64478.1, X62097.1 [ECO:0000332]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1107
                     /organism="Gallus gallus"
                     /mol_type="mRNA"
                     /db_xref="taxon:9031"
                     /chromosome="13"
                     /map="13"
     gene            1..1107
                     /gene="MSX2"
                     /gene_synonym="HOX-8; Msx-2"
                     /note="msh homeobox 2"
                     /db_xref="CGNC:66198"
                     /db_xref="GeneID:395245"
     exon            1..456
                     /gene="MSX2"
                     /gene_synonym="HOX-8; Msx-2"
                     /inference="alignment:Splign:2.1.0"
     CDS             102..881
                     /gene="MSX2"
                     /gene_synonym="HOX-8; Msx-2"
                     /note="homeobox-containing Hox-8; CHOX-8; GHox-8; homeobox
                     protein Hox-8; msh homeobox homolog 2; msh homeo box
                     homolog 2"
                     /codon_start=1
                     /product="homeobox protein MSX-2"
                     /protein_id="NP_989890.1"
                     /db_xref="CGNC:66198"
                     /db_xref="GeneID:395245"
                     /translation="
MASPSKAKEVFSSDEEGPAAGAEEHHKVKVSSLPFSVEALMSDKKPPKELPLAAAGGSADGATVGTSRNLLLPGHGSRDAHSPPGALTKTFDTASVKSENSEDGTSWIQEAGRYSPPPRHLSPTACTLRKHKTNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLNLTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPMLPSGFSLPFPINSPIQAASLYGTSYPFHRPVLPIPPVGLYATPVGYSMYHLS"
     misc_feature    order(504..518,522..524,573..575,591..593,630..632,
                     636..641,648..653,657..665,669..674)
                     /gene="MSX2"
                     /gene_synonym="HOX-8; Msx-2"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    510..671
                     /gene="MSX2"
                     /gene_synonym="HOX-8; Msx-2"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:278475"
     misc_feature    order(510..512,519..521,639..641,648..653,660..662)
                     /gene="MSX2"
                     /gene_synonym="HOX-8; Msx-2"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     exon            457..1107
                     /gene="MSX2"
                     /gene_synonym="HOX-8; Msx-2"
                     /inference="alignment:Splign:2.1.0"
     STS             457..1104
                     /gene="MSX2"
                     /gene_synonym="HOX-8; Msx-2"
                     /standard_name="ROS0065"
                     /db_xref="UniSTS:280266"
ORIGIN      
cggctccgcagcgcctcactcgcgcagtccccgcgcagggccgggcagaggcgcacgcagctccccgggcggccccgctccagccacgctccgcattcgcgatggcttctccttccaaagcgaaggaggttttctcctccgacgaggagggcccggcggccggcgccgaggagcaccacaaagtcaaggtgtccagcttgccgttcagcgtggaagccctcatgtccgacaagaaaccccctaaagagctgccgctggccgcggcggggggcagcgccgacggggcgaccgtgggcacctccaggaacctgctgctgccgggccacggctcccgggacgcgcacagcccccccggggctcttacaaaaaccttcgacaccgcttcggtcaaatcggagaactcggaggacggcacgtcctggatccaagaggccgggagatattcgcctcctccaagacacctgagccctacagcctgcactctgaggaagcacaagacgaatcggaagccccgcaccccattcactacttcccagctgctggccctggagcgcaagttccgccagaagcagtacctgtccatcgccgagcgagccgaattctccagctccctcaacctcacagagacccaggtcaaaatctggttccaaaatcggagggccaaggccaagagactgcaggaggctgagctagagaagctcaaaatggcagcgaagccaatgttgccgtcggggttcagcctccctttccccatcaactcccccatccaggccgcctcactgtacggaacatcctacccttttcacagacctgtgcttcctatcccgcccgttggactctatgctactcctgtcggatatagcatgtaccacttatcttaaggagatcagaaaggcacggtgacagcgagagagacttcctggtggatctcatccagcctcaagaatgcagtacccaaccggtactggccgttctttctgcacgcttctatctgccatcccgagtgtacaggagttcgcgttagcaaagcaaggcatcctgtatgcaacaggctgggtgtcttctgagagcgctctgagtgctcacagtctgatcctcagagtgttt
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]