GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-07-24 00:37:16, GGRNA.v2 : RefSeq release 224 (May, 2024)

LOCUS       NM_200601               2142 bp    mRNA    linear   VRT 09-APR-2020
DEFINITION  Danio rerio paralemmin 1b (palm1b), mRNA.
ACCESSION   NM_200601
VERSION     NM_200601.1
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
REFERENCE   1  (bases 1 to 2142)
  AUTHORS   Bayes A, Collins MO, Reig-Viader R, Gou G, Goulding D, Izquierdo A,
            Choudhary JS, Emes RD and Grant SG.
  TITLE     Evolution of complexity in the zebrafish synapse proteome
  JOURNAL   Nat Commun 8, 14613 (2017)
   PUBMED   28252024
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 2142)
  AUTHORS   Elkon R, Milon B, Morrison L, Shah M, Vijayakumar S, Racherla M,
            Leitch CC, Silipino L, Hadi S, Weiss-Gayet M, Barras E, Schmid CD,
            Ait-Lounis A, Barnes A, Song Y, Eisenman DJ, Eliyahu E, Frolenkov
            GI, Strome SE, Durand B, Zaghloul NA, Jones SM, Reith W and
            Hertzano R.
  TITLE     RFX transcription factors are essential for hearing in mice
  JOURNAL   Nat Commun 6, 8549 (2015)
   PUBMED   26469318
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 2142)
  AUTHORS   Aoki M, Segawa H, Naito M and Okamoto H.
  TITLE     Identification of possible downstream genes required for the
            extension of peripheral axons in primary sensory neurons
  JOURNAL   Biochem. Biophys. Res. Commun. 445 (2), 357-362 (2014)
   PUBMED   24513284
REFERENCE   4  (bases 1 to 2142)
  AUTHORS   Konzer A, Ruhs A, Braun H, Jungblut B, Braun T and Kruger M.
  TITLE     Stable isotope labeling in zebrafish allows in vivo monitoring of
            cardiac morphogenesis
  JOURNAL   Mol. Cell Proteomics 12 (6), 1502-1512 (2013)
   PUBMED   23412571
REFERENCE   5  (bases 1 to 2142)
  AUTHORS   Hultqvist G, Ocampo Daza D, Larhammar D and Kilimann MW.
  TITLE     Evolution of the vertebrate paralemmin gene family: ancient origin
            of gene duplicates suggests distinct functions
  JOURNAL   PLoS ONE 7 (7), e41850 (2012)
   PUBMED   22855693
REFERENCE   6  (bases 1 to 2142)
  AUTHORS   Mei W, Lee KW, Marlow FL, Miller AL and Mullins MC.
  TITLE     hnRNP I is required to generate the Ca2+ signal that causes egg
            activation in zebrafish
  JOURNAL   Development 136 (17), 3007-3017 (2009)
   PUBMED   19666827
REFERENCE   7  (bases 1 to 2142)
  AUTHORS   Ju Z, Wells MC, Martinez A, Hazlewood L and Walter RB.
  TITLE     An in silico mining for simple sequence repeats from expressed
            sequence tags of zebrafish, medaka, Fundulus, and Xiphophorus
  JOURNAL   In Silico Biol. (Gedrukt) 5 (5-6), 439-463 (2005)
   PUBMED   16268789
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from BC056777.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC056777.1, AW421856.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA3714643, SAMEA3714654
                                           [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..2142
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /strain="AB"
                     /db_xref="taxon:7955"
                     /chromosome="2"
                     /map="2"
     gene            1..2142
                     /gene="palm1b"
                     /gene_synonym="zgc:63523"
                     /note="paralemmin 1b"
                     /db_xref="GeneID:393573"
                     /db_xref="ZFIN:ZDB-GENE-040426-1147"
     exon            1..117
                     /gene="palm1b"
                     /gene_synonym="zgc:63523"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    59..61
                     /gene="palm1b"
                     /gene_synonym="zgc:63523"
                     /note="upstream in-frame stop codon"
     exon            118..163
                     /gene="palm1b"
                     /gene_synonym="zgc:63523"
                     /inference="alignment:Splign:2.1.0"
     CDS             119..853
                     /gene="palm1b"
                     /gene_synonym="zgc:63523"
                     /codon_start=1
                     /product="paralemmin 1b"
                     /protein_id="NP_956895.1"
                     /db_xref="GeneID:393573"
                     /db_xref="ZFIN:ZDB-GENE-040426-1147"
                     /translation="
MSEALSQQERLRAITEKRKKEAEIENKRRQLEDDRRQLQHLKSKALRERWLLDGAPSSGEDEAQKQLQEDEAKTKLLEETILRLEQEIDELETGVPLNKGEKQGNENAPDGPLKVENGIQQPSPDQNSKKQITGIEAKLQCTNPDAAIENASAEHPITMVFMGYKNVEDEAETKKTLGIEETVKAEFVVIEDGESKAGNEGAKNDQAPPNGSASSPDKADAKKEESKEEANSKEKQPCKCCTVM"
     misc_feature    164..760
                     /gene="palm1b"
                     /gene_synonym="zgc:63523"
                     /note="MIU-linker domain found in unconventional
                     myosin-VI; Region: MYO6_MIU_linker; cl46503"
                     /db_xref="CDD:480843"
     exon            164..244
                     /gene="palm1b"
                     /gene_synonym="zgc:63523"
                     /inference="alignment:Splign:2.1.0"
     exon            245..366
                     /gene="palm1b"
                     /gene_synonym="zgc:63523"
                     /inference="alignment:Splign:2.1.0"
     exon            367..439
                     /gene="palm1b"
                     /gene_synonym="zgc:63523"
                     /inference="alignment:Splign:2.1.0"
     exon            440..461
                     /gene="palm1b"
                     /gene_synonym="zgc:63523"
                     /inference="alignment:Splign:2.1.0"
     exon            462..2124
                     /gene="palm1b"
                     /gene_synonym="zgc:63523"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
agcaactgaaatctgcaggaaggtagctctccaggaacaggattggccacccttggtctagtatatacaagaaagttgcaatcaacctcacattataggcgtggagtacaacaaaaagatgtcggaagctttgtcacagcaagagagacttcgggccattactgaaaagagaaagaaggaggctgagattgagaacaaaagaagacaactggaggatgatcgccgacaactccagcatctcaagtcaaaggcattgagggagcgatggctgttggacggagcgccatccagtggagaagacgaggcacagaaacaactacaagaggacgaagccaagaccaaactgctggaggagaccatcctcagactagaacaggaaatcgacgagcttgaaactggtgtgcctttgaataaaggagaaaaacagggcaatgaaaatgcacctgatggtccactgaaggtagagaatggcatacagcagcccagcccagatcaaaacagcaagaaacagatcaccggcattgaggccaaactgcagtgcacaaaccccgacgcggccattgagaacgccagcgctgagcatcccataaccatggtcttcatgggctacaagaacgtggaggacgaggccgagacaaagaagacgctgggcatcgaggaaacagtaaaagctgaattcgtggtcatcgaggatggcgagagcaaagcaggaaacgaaggggccaaaaacgaccaggctccaccaaacggcagcgcctccagtcctgacaaagctgacgccaagaaggaggagtcgaaagaagaggccaattcgaaagaaaagcagccctgcaagtgctgcacagtcatgtaaccctcgaaatgtaggctctgacccccctgaccataacgcaacaatgaagaagtataccccgtatactgacgattaacttttgttgtctagtatgtatttctttttttatttctattaatatttttctatatttcttgtcttgacatttatatatctatatatacatatattttcattatgtaatcttatgaagtccagtattttgctcgtcgaagaacagaaaaatgaggaccacaactgactccactttagacaacaccacggttttaaagaacatttttgtggccctcgcccttatttttgttttaagaaagataagataaacgtctcgatatataaaatgaactagctatttatctcccgtatacatttgtgttttaagatattactttattactgagaagaaatgactatattgatattacgatgttatgcttttaatatatattttgagccttctgttttaatatttcttttgtggtttttgccaaatcatctcagaccactgtgaacactggtacatgtgtagtctttgtccacgatcacacgttattatgcattacacttcatagtagcccgatacgtttgtaaatacgatccagttatttatgactgttcatgctatggtagaacacatttagtcatgttgtttaaaataggacacgttaattaccccagatctccatcataatcacagcaaatatccgctttaacagtacatcactttttatagctgaataatatttataagataacccaatttttttttcctgcagtacatcaaagataacattgttagatataatagtaatcaatgcctcatattgcatatatgtagcccatactgttaaaatgcatttttactgtatgcaaaatatatctttataataatttttttgttgttggggggagaatgcattatttaaaggtttttgatgttaattcacgattccctcaactaaacgagtccaggaatctagtttcaacattcaggcgtttgattcataacaatgaatcattcattagtgttaattcgagttgaaaagtctggggtctaaaacacatttctcattccaagaccactagctctgtaaatgtagttttgccgtctttaagatatttcgatttgacttattatttcattttgtgtaagacagtatgtgttgtggattatgtcatgagttataggtgcttattggtatggccaatgcctgttatggtccaagtgtttaaatcaggaacaataaataagaaaaaaaaaagtttgtttaaaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]