ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-06-17 09:35:22, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS NM_182690 1108 bp mRNA linear PRI 27-APR-2025
DEFINITION Homo sapiens ephrin A4 (EFNA4), transcript variant 3, mRNA.
ACCESSION NM_182690
VERSION NM_182690.3
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1108)
AUTHORS Yuan,W., Zhao,H., Zhou,A. and Wang,S.
TITLE Interference of EFNA4 suppresses cell proliferation, invasion and
angiogenesis in hepatocellular carcinoma by downregulating PYGO2
JOURNAL Cancer Biol Ther 23 (1), 1-12 (2022)
PUBMED 36404439
REMARK GeneRIF: Interference of EFNA4 suppresses cell proliferation,
invasion and angiogenesis in hepatocellular carcinoma by
downregulating PYGO2.
REFERENCE 2 (bases 1 to 1108)
AUTHORS Kousathanas,A., Pairo-Castineira,E., Rawlik,K., Stuckey,A.,
Odhams,C.A., Walker,S., Russell,C.D., Malinauskas,T., Wu,Y.,
Millar,J., Shen,X., Elliott,K.S., Griffiths,F., Oosthuyzen,W.,
Morrice,K., Keating,S., Wang,B., Rhodes,D., Klaric,L., Zechner,M.,
Parkinson,N., Siddiq,A., Goddard,P., Donovan,S., Maslove,D.,
Nichol,A., Semple,M.G., Zainy,T., Maleady-Crowe,F., Todd,L.,
Salehi,S., Knight,J., Elgar,G., Chan,G., Arumugam,P., Patch,C.,
Rendon,A., Bentley,D., Kingsley,C., Kosmicki,J.A., Horowitz,J.E.,
Baras,A., Abecasis,G.R., Ferreira,M.A.R., Justice,A., Mirshahi,T.,
Oetjens,M., Rader,D.J., Ritchie,M.D., Verma,A., Fowler,T.A.,
Shankar-Hari,M., Summers,C., Hinds,C., Horby,P., Ling,L.,
McAuley,D., Montgomery,H., Openshaw,P.J.M., Elliott,P., Walsh,T.,
Tenesa,A., Fawkes,A., Murphy,L., Rowan,K., Ponting,C.P., Vitart,V.,
Wilson,J.F., Yang,J., Bretherick,A.D., Scott,R.H., Hendry,S.C.,
Moutsianas,L., Law,A., Caulfield,M.J. and Baillie,J.K.
CONSRTM GenOMICC investigators; 23andMe investigators; COVID-19 Human
Genetics Initiative
TITLE Whole-genome sequencing reveals host factors underlying critical
COVID-19
JOURNAL Nature 607 (7917), 97-103 (2022)
PUBMED 35255492
REFERENCE 3 (bases 1 to 1108)
AUTHORS Huttlin,E.L., Bruckner,R.J., Navarrete-Perea,J., Cannon,J.R.,
Baltier,K., Gebreab,F., Gygi,M.P., Thornock,A., Zarraga,G., Tam,S.,
Szpyt,J., Gassaway,B.M., Panov,A., Parzen,H., Fu,S., Golbazi,A.,
Maenpaa,E., Stricker,K., Guha Thakurta,S., Zhang,T., Rad,R.,
Pan,J., Nusinow,D.P., Paulo,J.A., Schweppe,D.K., Vaites,L.P.,
Harper,J.W. and Gygi,S.P.
TITLE Dual proteome-scale networks reveal cell-specific remodeling of the
human interactome
JOURNAL Cell 184 (11), 3022-3040 (2021)
PUBMED 33961781
REFERENCE 4 (bases 1 to 1108)
AUTHORS Chen,Y.L., Yen,Y.C., Jang,C.W., Wang,S.H., Huang,H.T., Chen,C.H.,
Hsiao,J.R., Chang,J.Y. and Chen,Y.W.
TITLE Ephrin A4-ephrin receptor A10 signaling promotes cell migration and
spheroid formation by upregulating NANOG expression in oral
squamous cell carcinoma cells
JOURNAL Sci Rep 11 (1), 644 (2021)
PUBMED 33436772
REMARK GeneRIF: Ephrin A4-ephrin receptor A10 signaling promotes cell
migration and spheroid formation by upregulating NANOG expression
in oral squamous cell carcinoma cells.
Publication Status: Online-Only
REFERENCE 5 (bases 1 to 1108)
AUTHORS Luck,K., Kim,D.K., Lambourne,L., Spirohn,K., Begg,B.E., Bian,W.,
Brignall,R., Cafarelli,T., Campos-Laborie,F.J., Charloteaux,B.,
Choi,D., Cote,A.G., Daley,M., Deimling,S., Desbuleux,A., Dricot,A.,
Gebbia,M., Hardy,M.F., Kishore,N., Knapp,J.J., Kovacs,I.A.,
Lemmens,I., Mee,M.W., Mellor,J.C., Pollis,C., Pons,C.,
Richardson,A.D., Schlabach,S., Teeking,B., Yadav,A., Babor,M.,
Balcha,D., Basha,O., Bowman-Colin,C., Chin,S.F., Choi,S.G.,
Colabella,C., Coppin,G., D'Amata,C., De Ridder,D., De Rouck,S.,
Duran-Frigola,M., Ennajdaoui,H., Goebels,F., Goehring,L., Gopal,A.,
Haddad,G., Hatchi,E., Helmy,M., Jacob,Y., Kassa,Y., Landini,S.,
Li,R., van Lieshout,N., MacWilliams,A., Markey,D., Paulson,J.N.,
Rangarajan,S., Rasla,J., Rayhan,A., Rolland,T., San-Miguel,A.,
Shen,Y., Sheykhkarimli,D., Sheynkman,G.M., Simonovsky,E., Tasan,M.,
Tejeda,A., Tropepe,V., Twizere,J.C., Wang,Y., Weatheritt,R.J.,
Weile,J., Xia,Y., Yang,X., Yeger-Lotem,E., Zhong,Q., Aloy,P.,
Bader,G.D., De Las Rivas,J., Gaudet,S., Hao,T., Rak,J.,
Tavernier,J., Hill,D.E., Vidal,M., Roth,F.P. and Calderwood,M.A.
TITLE A reference map of the human binary protein interactome
JOURNAL Nature 580 (7803), 402-408 (2020)
PUBMED 32296183
REFERENCE 6 (bases 1 to 1108)
AUTHORS Zhou,R.
TITLE The Eph family receptors and ligands
JOURNAL Pharmacol Ther 77 (3), 151-181 (1998)
PUBMED 9576626
REMARK Review article
REFERENCE 7 (bases 1 to 1108)
AUTHORS Flanagan,J.G. and Vanderhaeghen,P.
TITLE The ephrins and Eph receptors in neural development
JOURNAL Annu Rev Neurosci 21, 309-345 (1998)
PUBMED 9530499
REMARK Review article
REFERENCE 8 (bases 1 to 1108)
AUTHORS Gale,N.W., Holland,S.J., Valenzuela,D.M., Flenniken,A., Pan,L.,
Ryan,T.E., Henkemeyer,M., Strebhardt,K., Hirai,H., Wilkinson,D.G.,
Pawson,T., Davis,S. and Yancopoulos,G.D.
TITLE Eph receptors and ligands comprise two major specificity subclasses
and are reciprocally compartmentalized during embryogenesis
JOURNAL Neuron 17 (1), 9-19 (1996)
PUBMED 8755474
REFERENCE 9 (bases 1 to 1108)
AUTHORS Cerretti,D.P., Lyman,S.D., Kozlosky,C.J., Copeland,N.G.,
Gilbert,D.J., Jenkins,N.A., Valentine,V., Kirstein,M.N.,
Shapiro,D.N. and Morris,S.W.
TITLE The genes encoding the eph-related receptor tyrosine kinase ligands
LERK-1 (EPLG1, Epl1), LERK-3 (EPLG3, Epl3), and LERK-4 (EPLG4,
Epl4) are clustered on human chromosome 1 and mouse chromosome 3
JOURNAL Genomics 33 (2), 277-282 (1996)
PUBMED 8660976
REFERENCE 10 (bases 1 to 1108)
AUTHORS Kozlosky,C.J., Maraskovsky,E., McGrew,J.T., VandenBos,T., Teepe,M.,
Lyman,S.D., Srinivasan,S., Fletcher,F.A., Gayle,R.B. 3rd,
Cerretti,D.P. et al.
TITLE Ligands for the receptor tyrosine kinases hek and elk: isolation of
cDNAs encoding a family of proteins
JOURNAL Oncogene 10 (2), 299-306 (1995)
PUBMED 7838529
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from BM740848.1, AJ006353.1 and
AL691442.32.
On May 31, 2019 this sequence version replaced NM_182690.2.
Summary: This gene encodes a member of the ephrin (EPH) family. The
ephrins and EPH-related receptors comprise the largest subfamily of
receptor protein-tyrosine kinases and have been implicated in
mediating developmental events, especially in the nervous system
and in erythropoiesis. Based on their structures and sequence
relationships, ephrins are divided into the ephrin-A (EFNA) class,
which are anchored to the membrane by a
glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB)
class, which are transmembrane proteins. This gene encodes an EFNA
class ephrin that has been implicated in proliferation and
metastasis of several types of cancers. [provided by RefSeq, May
2022].
Transcript Variant: This variant (3), also known as ephrin-A4 (s),
uses an alternate splice site in the 3' coding region, compared to
variant 1, that results in a downstream translation termination. It
encodes isoform c which has a distinct and slightly shorter
C-terminus compared to isoform a. Isoform c lacks a characteristic
transmembrane domain and the GPI-signal sequence contained in
isoform a. Isoform c is a secreted molecule.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: AJ006353.1, DRR138513.144520.1
[ECO:0000332]
##Evidence-Data-END##
##RefSeq-Attributes-START##
coronavirus related :: locus in the vicinity of disease-associated
variant(s)
##RefSeq-Attributes-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-435 BM740848.1 4-438
436-833 AJ006353.1 379-776
834-1108 AL691442.32 17551-17825
FEATURES Location/Qualifiers
source 1..1108
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="1"
/map="1q21.3"
gene 1..1108
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/note="ephrin A4"
/db_xref="GeneID:1945"
/db_xref="HGNC:HGNC:3224"
/db_xref="MIM:601380"
exon 1..197
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/inference="alignment:Splign:2.1.0"
variation 1
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1571648074"
variation 2
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1056175760"
variation 3
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:539593653"
variation 4
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:949761401"
variation 5
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:2526434714"
variation 8
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:2526434733"
variation 9
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1044174413"
variation 10
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:905998730"
variation 11
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:941502694"
variation 12
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:2526434816"
variation 13..15
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="t"
/replace="tgt"
/db_xref="dbSNP:1662879747"
variation 13
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1464119917"
variation 14
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1002230"
variation 15
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:2526434877"
variation 16
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:1571648146"
variation 17
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1170853712"
variation 18
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:369610690"
variation 19
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:2526434979"
variation 21..26
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="tc"
/replace="tctctc"
/db_xref="dbSNP:964695884"
variation 21
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:2526434988"
variation 22
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1182087715"
variation 25
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:2102437167"
variation 26
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:897387079"
variation 27
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:2526435060"
variation 28
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1662881223"
variation 29
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1558137938"
variation 30
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:994855515"
variation 32
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1662881720"
variation 33
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:2526435123"
variation 34
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1433143254"
variation 35
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1662881992"
variation 36..37
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace=""
/replace="ga"
/db_xref="dbSNP:2526435178"
variation 36
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:2526435169"
variation 38
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:2526435185"
variation 40
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1662882112"
variation 41
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1322365129"
variation 42
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1365659493"
variation 43
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1051079881"
variation 44
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1282376546"
variation 45
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1358327937"
variation 46..48
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="ggg"
/replace="gggg"
/db_xref="dbSNP:1181310223"
variation 46
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1662883179"
variation 47
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:2526435286"
variation 48
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:955424484"
variation 49
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1228436701"
variation 51
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:2526435311"
variation 52
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:750018113"
variation 53..62
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="gccaggccag"
/replace="gccaggccaggccag"
/db_xref="dbSNP:1253948957"
variation 53
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1463310416"
variation 54
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:958220768"
variation 55
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1248187187"
variation 56
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:2526435387"
variation 58
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:2526435398"
variation 59..60
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="cc"
/db_xref="dbSNP:1662884907"
variation 59
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1219973346"
variation 60
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:988198140"
variation 62
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:758048320"
variation 64
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:779821500"
variation 67
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:914050693"
variation 68
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:2526435467"
variation 69
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:946855865"
variation 71
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1163962401"
variation 72
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:2526435587"
variation 73
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1411314602"
variation 74
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:2526435611"
variation 75
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1455908012"
variation 77
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:746766754"
variation 78..82
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="ggggg"
/replace="gggggg"
/db_xref="dbSNP:2526435664"
variation 78
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1662886993"
variation 81
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:2526435677"
variation 82
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:2526435696"
variation 83
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:2526435709"
variation 84
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1043928491"
CDS 85..666
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/note="isoform c precursor is encoded by transcript
variant 3; ligand of eph-related kinase 4; eph-related
receptor tyrosine kinase ligand 4"
/codon_start=1
/product="ephrin-A4 isoform c precursor"
/protein_id="NP_872632.2"
/db_xref="CCDS:CCDS41407.1"
/db_xref="GeneID:1945"
/db_xref="HGNC:HGNC:3224"
/db_xref="MIM:601380"
/translation="
MRLLPLLRTVLWAAFLGSPLRGGSSLRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPHYEGPGPPEGPETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSLGFEFLPGETYYYISVPTPESSGQCLRLQVSVCCKERNLPSHPKEPESSQDPLEEEGSLLPALGVPIQTDKMEH"
sig_peptide 85..150
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/inference="COORDINATES: ab initio prediction:SignalP:6.0"
misc_feature 163..540
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/note="Ectodomain of Ephrin A; Region:
Ephrin-A_Ectodomain; cd10425"
/db_xref="CDD:259896"
misc_feature order(241..243,364..378,403..408,427..444,448..453)
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/note="receptor binding site [polypeptide binding]; other
site"
/db_xref="CDD:259896"
variation 85
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:1662887221"
variation 86
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:2526435765"
variation 87
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:754852081"
variation 88
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:926859436"
variation 89
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:2102437399"
variation 90
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:2526435840"
variation 92
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:938282528"
variation 93
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:2526435857"
variation 94
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:2526435869"
variation 95
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:2526435880"
variation 96
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:2526435891"
variation 98
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1448650572"
variation 99
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1429093184"
variation 100
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:2102437421"
variation 101
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1278509153"
variation 102
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:2526435961"
variation 104
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:2526435973"
variation 105
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:2526435993"
variation 106
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:2526436004"
variation 107
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1326461416"
variation 108
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:780960543"
variation 109
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1553267248"
variation 110
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:2526436060"
variation 111
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:2526436072"
variation 112
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1403415249"
variation 113
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1662888815"
variation 114
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:2526436110"
variation 115
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:891128045"
variation 116
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:2526436130"
variation 117
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:12760718"
variation 119
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:2526436171"
variation 121
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1349674156"
variation 122
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:2526436197"
variation 123
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:2526436209"
variation 124
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1006894326"
variation 125
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1322354491"
variation 126
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:111269205"
variation 131
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:2526436266"
variation 132
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1662889826"
variation 133
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1254487338"
variation 134
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:868405546"
variation 135
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:2526436323"
variation 137
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1444693034"
variation 138
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1662890317"
variation 139
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:2526436384"
variation 140
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:968141432"
variation 142
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:771087028"
variation 144
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1157743046"
variation 145
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:2526436433"
variation 146
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:865897803"
variation 147
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:774589466"
variation 148..152
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="gggg"
/replace="ggggg"
/db_xref="dbSNP:2526436480"
variation 148
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:2526436462"
variation 149
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1471660146"
variation 150
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1184386171"
variation 151
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1662891331"
variation 152
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1413024884"
variation 153
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1414009017"
variation 154
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:746026404"
variation 155
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:772406343"
variation 156
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:2526436595"
variation 157
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1033285451"
variation 158
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1662892512"
variation 159
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1197207739"
variation 160
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:2526436645"
variation 161
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:1232431969"
variation 162
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:2526436661"
variation 163
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1414753641"
variation 164
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:1307352212"
variation 165
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1348498880"
variation 167
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:2526436717"
variation 168
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1411162602"
variation 169
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1662893318"
variation 170
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace=""
/replace="t"
/db_xref="dbSNP:2526436776"
variation 171
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace=""
/replace="a"
/db_xref="dbSNP:1558138217"
variation 171
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:2526436789"
variation 175
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:896160038"
variation 176
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1662893722"
variation 177
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1288397903"
variation 178
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:543428198"
variation 179
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:2526436863"
variation 180
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:2526436873"
variation 181
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:993214956"
variation 183
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1230597690"
variation 185..186
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="cc"
/db_xref="dbSNP:2526436912"
variation 185
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:2526436905"
variation 186
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1254696715"
variation 187
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1347586578"
variation 188
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1201332848"
variation 189
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:760930080"
variation 190..191
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="aa"
/db_xref="dbSNP:1662894831"
variation 191
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:2526436977"
variation 192..195
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="cccc"
/replace="ccccc"
/db_xref="dbSNP:2526437124"
variation 192
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:764545146"
variation 193
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:2526437131"
variation 194
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1227854348"
variation 195
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:776966466"
variation 197
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1290688935"
exon 198..484
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/inference="alignment:Splign:2.1.0"
variation 198
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663054146"
variation 205
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1391062717"
variation 206
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:762225853"
variation 207
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663054383"
variation 211
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:770282147"
variation 213
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:773749190"
variation 214
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:745549912"
variation 216
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:146980401"
variation 217
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:142249822"
variation 220
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:2526456384"
variation 223
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:2526456390"
variation 224
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:2526456399"
variation 226
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1242749612"
variation 227
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663054982"
variation 230
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:2526456425"
variation 233
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1267281203"
variation 235
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:2526456441"
variation 236
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:927730429"
variation 237
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:369664889"
variation 238
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:767156779"
variation 242
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:1571653198"
variation 243
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:780175061"
variation 244
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1341898292"
variation 245
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:2526456514"
variation 247
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:2526456524"
variation 250
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:2526456534"
variation 251
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1215432400"
variation 252..257
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="tg"
/replace="tgtctg"
/db_xref="dbSNP:1466098975"
variation 253
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:2526456552"
variation 255
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:2526456561"
variation 256
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:2526456569"
variation 257
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:2526456579"
variation 258..262
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="ccccc"
/replace="cccccc"
/db_xref="dbSNP:2526456593"
variation 258
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:2526456585"
variation 259
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:752523859"
variation 261
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1663055861"
variation 262
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:148289726"
variation 263
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:199992371"
variation 265
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:1166365914"
variation 267
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:542869546"
variation 268
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:780190233"
variation 269
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:2526456664"
variation 270
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:2526456673"
variation 271
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:2526456679"
variation 274
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:2526456697"
variation 276
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:2526456701"
variation 277..279
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="gg"
/replace="ggg"
/db_xref="dbSNP:2526456716"
variation 277
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:2102443103"
variation 278
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:370756589"
variation 279
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:781461644"
variation 280..284
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="ccccc"
/replace="cccccc"
/replace="ccccccc"
/db_xref="dbSNP:775997490"
variation 280
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:199831867"
variation 281
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:199824664"
variation 282
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:773661006"
variation 283
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663057149"
variation 284..285
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace=""
/replace="ct"
/db_xref="dbSNP:2526456774"
variation 284
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1553267556"
variation 285..289
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace=""
/replace="tgagg"
/db_xref="dbSNP:1663057416"
variation 285
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace=""
/replace="t"
/db_xref="dbSNP:764503763"
variation 286
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:2102443149"
variation 287
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace=""
/replace="a"
/db_xref="dbSNP:2526456794"
variation 287
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:2526456792"
variation 288
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663057497"
variation 289
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:2526456808"
variation 290
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:1240867561"
variation 292
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:2526456824"
variation 294
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:763481245"
variation 295
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:770278541"
variation 296
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:773922536"
variation 298
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace=""
/replace="a"
/db_xref="dbSNP:754285540"
variation 298
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:2526456860"
variation 299
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:201078911"
variation 300
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:541082385"
variation 306
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:2526456883"
variation 309
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:2102443179"
variation 310
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1266496575"
variation 312
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:2526456900"
variation 313
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:138277393"
variation 314..319
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="tgg"
/replace="tggtgg"
/db_xref="dbSNP:2526456924"
variation 314
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663058284"
variation 315
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:760519955"
variation 316
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:2526456945"
variation 318
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1255181016"
variation 319..323
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="gactg"
/db_xref="dbSNP:2526456958"
variation 321
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:774979817"
variation 324
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:753765092"
variation 326
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:368247612"
variation 327
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:778775987"
variation 328
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:997960767"
variation 329
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1179332137"
variation 330
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace=""
/replace="c"
/db_xref="dbSNP:2526457031"
variation 330
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1244820785"
variation 331..333
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="t"
/replace="tat"
/replace="tatat"
/db_xref="dbSNP:1413766725"
variation 333
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:370806650"
variation 334
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:201123791"
variation 335
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1663059303"
variation 336
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:2102443247"
variation 337
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:2526457094"
variation 338
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:200677884"
variation 339
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:2526457104"
variation 340
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:1663059534"
variation 342
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1464802967"
variation 344
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:1359699711"
variation 345
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:375400864"
variation 347
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663060007"
variation 349
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663060083"
variation 350
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="actcata"
/db_xref="dbSNP:1476256817"
variation 351
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663060334"
variation 352..353
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace=""
/replace="ca"
/db_xref="dbSNP:1168173419"
variation 353
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1431141714"
variation 354..358
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="ccccc"
/replace="cccccc"
/db_xref="dbSNP:758089508"
variation 354
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1004443861"
variation 355
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:2526457212"
variation 356
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1407731922"
variation 358
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1558139918"
variation 359..361
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="ggg"
/replace="gggg"
/db_xref="dbSNP:766100897"
variation 359
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:142999275"
variation 361
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:2526457323"
variation 362
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:1409322528"
variation 364
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1286500741"
variation 365
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663061730"
variation 366
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1663061841"
variation 368
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663061959"
variation 369
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1352621818"
variation 370
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:778114973"
variation 371
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:749698866"
variation 372
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1663062544"
variation 373
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1310232406"
variation 374..376
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="gg"
/replace="ggg"
/db_xref="dbSNP:1663062844"
variation 376
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:2526457499"
variation 377
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace=""
/replace="t"
/db_xref="dbSNP:2526457517"
variation 377
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:2526457508"
variation 378
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:1416250899"
variation 380
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:2526457537"
variation 381
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:544929070"
variation 383..384
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="cc"
/replace="tt"
/db_xref="dbSNP:866104265"
variation 387
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:953962875"
variation 388..389
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="cc"
/replace="cctttcgctcc"
/db_xref="dbSNP:1663064354"
variation 388
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663064257"
variation 391
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1280989380"
variation 395
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:2526457712"
variation 399
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:774783548"
variation 403
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:989804173"
variation 405
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663064628"
variation 408
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663064704"
variation 409
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663064781"
variation 411
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:563226989"
variation 414
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:2526457758"
variation 416
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1663064999"
variation 417
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:966768645"
variation 420
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:1253329399"
variation 423..426
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="gc"
/replace="gcgc"
/db_xref="dbSNP:2526457788"
variation 424
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:368795287"
variation 425
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:775247787"
variation 426
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:2526457821"
variation 431
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1422554226"
variation 432
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:1663065651"
variation 433..435
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="ccc"
/replace="cccc"
/db_xref="dbSNP:2526457861"
variation 433
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:143886639"
variation 434
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663065922"
variation 439
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:776556253"
variation 440
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1256233082"
variation 441
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:2526457889"
variation 444
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:761582524"
variation 445
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:765191806"
variation 447
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:750377879"
variation 450
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1372491408"
variation 453
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:2526457925"
variation 456
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:114301457"
variation 458
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:2526457948"
variation 459
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:767615043"
variation 460
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1365701872"
variation 463..464
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="gg"
/db_xref="dbSNP:1220776337"
variation 464..469
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="gaga"
/replace="gagaga"
/db_xref="dbSNP:2526457990"
variation 464
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:2526457981"
variation 469..475
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="act"
/replace="acttact"
/db_xref="dbSNP:2526458000"
variation 469
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663067062"
variation 470
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:752848379"
variation 471
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:2526458019"
variation 473
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="aa"
/db_xref="dbSNP:2526458040"
variation 473
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1291203787"
variation 474
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1341436553"
variation 475
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:1663067363"
variation 476
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:756341656"
variation 477
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:778025181"
variation 478
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:2526458134"
variation 479
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663067981"
variation 480
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:2102443491"
variation 482
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1437922306"
variation 484
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:1663068132"
exon 485..553
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/inference="alignment:Splign:2.1.0"
variation 485
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1213932996"
variation 486
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:151179474"
variation 487
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:1663077376"
variation 489
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:2526459832"
variation 492
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:41264287"
variation 493
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:1464742957"
variation 495
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:2526459886"
variation 496
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:2526459895"
variation 497
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:2526459905"
variation 499
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1187019544"
variation 501
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:764267914"
variation 502..504
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace=""
/replace="agt"
/db_xref="dbSNP:2526459937"
variation 503
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:2526459945"
variation 505..506
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace=""
/replace="gggca"
/db_xref="dbSNP:2526459950"
variation 506
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:201670234"
variation 508
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:2526459962"
variation 509
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:2102443869"
variation 513
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:757589642"
variation 515
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1663077888"
variation 517
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:141223577"
variation 519
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:908106668"
variation 521
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:746332488"
variation 522
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:142288768"
variation 524
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:2526460030"
variation 525
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:1463020576"
variation 528
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1663078385"
variation 529
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:2526460058"
variation 530
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:1663078450"
variation 533
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:2526460074"
variation 534..536
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="t"
/replace="tgt"
/db_xref="dbSNP:1241165316"
variation 534
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="t"
/replace="tt"
/db_xref="dbSNP:1663078516"
variation 535
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:780776065"
variation 537
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:746489131"
variation 538
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1447360049"
variation 539
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:768333356"
variation 543
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:2526460121"
variation 547
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:780848551"
variation 551
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:2526460181"
variation 552
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:2526460198"
exon 554..1108
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/inference="alignment:Splign:2.1.0"
variation 555..556
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="cc"
/db_xref="dbSNP:760995989"
variation 555
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1384413083"
variation 556
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:199947288"
variation 559
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:2526465665"
variation 560
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1339957778"
variation 561..565
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="ctc"
/replace="ctctc"
/db_xref="dbSNP:1558141164"
variation 561
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1017969863"
variation 562
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:2526465687"
variation 563
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:567168153"
variation 564
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:2102445596"
variation 565
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1553267703"
variation 568
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:201215681"
variation 570
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:758266087"
variation 571
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663119483"
variation 575
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:2526465740"
variation 576
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace=""
/replace="g"
/db_xref="dbSNP:2526465749"
variation 576
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:779807669"
variation 578
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:202246914"
variation 579
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:773440754"
variation 580
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:2526465768"
variation 581
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace=""
/replace="a"
/db_xref="dbSNP:749132073"
variation 581
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663119892"
variation 582
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1558141212"
variation 583..590
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace=""
/replace="tcctccca"
/db_xref="dbSNP:771046983"
variation 585
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663120130"
variation 587
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:2526465814"
variation 588
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:2526465821"
variation 589
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:2526465828"
variation 590
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:749435869"
variation 591
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:771274591"
variation 595
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:2526465857"
variation 598..599
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace=""
/replace="ca"
/db_xref="dbSNP:774703301"
variation 599
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace=""
/replace="t"
/db_xref="dbSNP:1558141229"
variation 599
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:774753006"
variation 603
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663120523"
variation 605
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:1553267706"
variation 606..607
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="gg"
/db_xref="dbSNP:746080148"
variation 610
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:759796184"
variation 611
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:2526465926"
variation 613
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:2526465932"
variation 614
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1472051023"
variation 616
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1158978226"
variation 617
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:767943701"
variation 620
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1455615031"
variation 621
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:889300332"
variation 625
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:775818108"
variation 627
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:1170496887"
variation 629
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="t"
/replace="tt"
/db_xref="dbSNP:2526465989"
variation 630..634
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="ggggg"
/replace="gggggg"
/db_xref="dbSNP:772130989"
variation 631
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:2526466014"
variation 633
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:2526466021"
variation 634
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:2526466028"
variation 635
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1402072773"
variation 636
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:2102445698"
variation 639..640
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace=""
/replace="aa"
/db_xref="dbSNP:775733013"
variation 640
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1571655799"
variation 643
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:761244893"
variation 644
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:763533997"
variation 646
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:2526466095"
variation 647
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663121737"
variation 648
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1228015744"
variation 649
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1021875220"
variation 651
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:748113318"
variation 652
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:2526466141"
variation 653
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:1663122081"
variation 656
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:2526466152"
variation 657..658
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="gg"
/db_xref="dbSNP:1216183664"
variation 658
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1663122196"
variation 663
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:772048174"
variation 666
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:2526466214"
variation 668
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:1484635748"
variation 670
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:2526466235"
variation 672
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:761356922"
variation 674
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:552355758"
variation 675
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1031690866"
variation 677
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:960070810"
variation 681
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:750115905"
variation 684
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:2526466274"
variation 687
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:758090033"
variation 688
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:2526466284"
variation 690
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:2526466297"
variation 691
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:2526466300"
variation 694..697
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="ct"
/replace="ctct"
/db_xref="dbSNP:2526466312"
variation 695
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:2526466320"
variation 698
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:916014726"
variation 699
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1472197427"
variation 700
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:779905284"
variation 701
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1421280494"
variation 703
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1553267728"
variation 704
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1160251060"
variation 706
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:570670486"
variation 709
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:915184543"
variation 711
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1314920375"
variation 713..716
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="cctc"
/db_xref="dbSNP:2526466410"
variation 714
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:2526466417"
variation 716
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663123547"
variation 717
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:1158480020"
variation 718
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:2102445821"
variation 719
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663123675"
variation 720
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:2526466458"
variation 721
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:2526466467"
variation 723
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1558141354"
variation 724
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:2526466486"
variation 728..734
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="aaga"
/replace="aagaaga"
/db_xref="dbSNP:761223567"
variation 729
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1409227720"
variation 735
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:2526466517"
variation 736
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:751395056"
variation 738
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:2526466538"
variation 740
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1663124021"
variation 742
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1375754714"
variation 745
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1204969278"
variation 746
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:754953222"
variation 747
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:781344227"
variation 749
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:2526466585"
variation 750
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:2526466591"
variation 751
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1345719917"
variation 753
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:749345800"
variation 754
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:2526466629"
variation 755..758
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="ct"
/replace="ctct"
/db_xref="dbSNP:1226859582"
variation 755
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1382096108"
variation 758
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:2526466647"
variation 759..774
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="gaagcagaggcaagac"
/replace="gaagcagaggcaagacgaagcagaggcaagac"
/db_xref="dbSNP:2526466651"
variation 761
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:2526466658"
variation 767
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1280886339"
variation 768
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:771183074"
variation 769
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:779226711"
variation 771
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663124751"
variation 772
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:746129864"
variation 773
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:2526466706"
variation 774
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1057273721"
variation 777..781
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="aca"
/replace="acaca"
/db_xref="dbSNP:764734484"
variation 780
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663125039"
variation 784
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:981034397"
variation 785
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:909117055"
variation 786
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663125260"
variation 788
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1162226299"
variation 792
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:2526466815"
variation 793
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:2526466823"
variation 794
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1404452992"
variation 799
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:2102445922"
variation 800
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:2526466834"
variation 805
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:2526466841"
variation 806
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:897335499"
variation 807
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1571655973"
variation 811
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:941954387"
variation 813
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:2526466864"
variation 814
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:2526466868"
variation 815
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:2526466875"
variation 818
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:2526466880"
variation 819
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:112399433"
variation 820
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1571655986"
variation 821
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1663125748"
variation 822
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663125800"
variation 823
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:2526466939"
variation 827
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:2526466942"
variation 828
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:2526466949"
variation 830..831
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace=""
/replace="ct"
/db_xref="dbSNP:1237514676"
variation 830
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663125846"
variation 831
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:888731911"
variation 832
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:538384115"
variation 833
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1006507102"
variation 835
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:2526466971"
variation 836
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:2526466981"
variation 837
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:2526466985"
variation 838
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:2526466991"
variation 841
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:2526466996"
variation 842
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:2526467002"
variation 843
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:2526467010"
variation 846
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:2526467013"
variation 847
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace=""
/replace="c"
/db_xref="dbSNP:2526467017"
variation 849
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:144763497"
variation 850
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:2526467025"
variation 853
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663126180"
variation 855
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1219627836"
variation 856
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:1663126295"
variation 857
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1359075712"
variation 859
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:2526467055"
variation 860
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:2526467062"
variation 862
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1292506153"
variation 865..869
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="gggg"
/replace="ggggg"
/db_xref="dbSNP:2526467091"
variation 865
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:2102445976"
variation 867
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1663126528"
variation 868
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1348896353"
variation 870..872
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="cc"
/replace="ccc"
/db_xref="dbSNP:2526467115"
variation 873
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1213257771"
variation 874
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1283668970"
variation 875..876
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace=""
/replace="tcttcagcctgggc"
/db_xref="dbSNP:2526467140"
variation 876
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663126882"
variation 880
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:1487835650"
variation 883
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:2526467169"
variation 884
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663127059"
variation 886
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:897500547"
variation 889
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663127195"
variation 892
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:563813867"
variation 893
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:2526467277"
variation 894
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:773104614"
variation 895
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:2102446017"
variation 896
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace=""
/replace="c"
/db_xref="dbSNP:1663127485"
variation 896
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1051454441"
variation 897
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:374633006"
variation 899
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663127614"
variation 900
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:2526467357"
variation 903
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1365820826"
variation 904
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:2526467401"
variation 906
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:2526467408"
variation 907..908
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="cc"
/db_xref="dbSNP:2526467415"
variation 908
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:2526467417"
variation 909
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1164880029"
variation 910
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1417352065"
variation 911
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:2526467434"
variation 913
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:2526467441"
variation 915..923
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="aagaag"
/replace="aagaagaag"
/db_xref="dbSNP:1379195799"
variation 917
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:888902933"
variation 921
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:956725684"
variation 923
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:2526467468"
variation 924..926
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="cc"
/replace="ccc"
/db_xref="dbSNP:989364734"
variation 925
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1007708289"
variation 926..927
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace=""
/replace="aggct"
/db_xref="dbSNP:1663128192"
variation 928
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1190413930"
variation 930
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1022239988"
variation 931
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace=""
/replace="a"
/db_xref="dbSNP:2526467527"
variation 931
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:2526467522"
variation 933
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1455348952"
variation 939
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:969296951"
variation 941
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="t"
/replace="tt"
/db_xref="dbSNP:1663128555"
variation 942
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:904745993"
variation 943
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:2526467642"
variation 947
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1224767589"
variation 949..952
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="ttt"
/replace="tttt"
/db_xref="dbSNP:2526467657"
variation 949
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663128731"
variation 954
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:2526467660"
variation 956
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:1487333217"
variation 957
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:2526467671"
variation 960
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:759728514"
variation 963
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:2526467680"
variation 964
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:2526467689"
variation 966
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1156430098"
variation 970
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace=""
/replace="g"
/db_xref="dbSNP:1663129224"
variation 970
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:564877955"
variation 973
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663129286"
variation 974
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:2526467724"
variation 975
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:2526467730"
variation 978
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663129334"
variation 982
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:1240377298"
variation 983
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1319327545"
variation 986
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:2526467758"
variation 987
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:1663129495"
variation 988
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1663129542"
variation 990
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:775819390"
variation 991..994
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace=""
/replace="actt"
/db_xref="dbSNP:1223300097"
variation 991
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:927294280"
variation 992
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1663129834"
variation 1000
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663129924"
variation 1001
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1304546371"
variation 1002
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663130022"
variation 1007
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:2526467833"
variation 1009
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:769750020"
variation 1010..1011
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="gg"
/db_xref="dbSNP:1663130253"
variation 1010
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:536226496"
variation 1013
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:2526467866"
variation 1014
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:2526467876"
variation 1021
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663130312"
variation 1038
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1455222047"
variation 1042
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663130422"
variation 1043
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1375872284"
variation 1047..1051
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="tttt"
/replace="ttttt"
/db_xref="dbSNP:2526467909"
variation 1052
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1057458627"
variation 1053
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:1663130596"
variation 1054
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:2526467952"
variation 1056
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663130642"
variation 1057
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:554241024"
variation 1060
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663130752"
variation 1062
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663130822"
variation 1063
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1175030350"
variation 1064
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663130949"
variation 1065
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1480659387"
variation 1068
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:2526468004"
variation 1069
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663131048"
variation 1070
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:573097675"
regulatory 1075..1080
/regulatory_class="polyA_signal_sequence"
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/note="hexamer: AATAAA"
variation 1075
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663131335"
variation 1076
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:1663131390"
variation 1077
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:930126542"
variation 1078
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1476999346"
variation 1081
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1261129343"
variation 1089
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace=""
/replace="c"
/db_xref="dbSNP:1663131754"
variation 1091
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:1663131849"
variation 1093..1098
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="ttg"
/replace="ttgttg"
/db_xref="dbSNP:1663131940"
variation 1104
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:2526468095"
variation 1105
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:540427499"
variation 1107
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:2526468111"
polyA_site 1108
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/note="major polyA site"
variation 1108
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1325361549"
ORIGIN
ccctcttcactttgtacctttctctcctcgactgtgaagcgggccgggacctgccaggccagaccaaaccggacctcgggggcgatgcggctgctgcccctgctgcggactgtcctctgggccgcgttcctcggctcccctctgcgcgggggctccagcctccgccacgtagtctactggaactccagtaaccccaggttgcttcgaggagacgccgtggtggagctgggcctcaacgattacctagacattgtctgcccccactacgaaggcccagggccccctgagggccccgagacgtttgctttgtacatggtggactggccaggctatgagtcctgccaggcagagggcccccgggcctacaagcgctgggtgtgctccctgccctttggccatgttcaattctcagagaagattcagcgcttcacacccttctccctcggctttgagttcttacctggagagacttactactacatctcggtgcccactccagagagttctggccagtgcttgaggctccaggtgtctgtctgctgcaaggagaggaaccttccctctcatcccaaggagccagagtcctcccaagatcccctggaggaggagggatccctgctgcctgcactgggggtgccaattcagaccgacaagatggagcattgatgggggagatcagagggtctgaggtgactcttgcaggagcctgtcccctcatcacaggctaaagaagagcagtagacagccctggacactctgaagcagaggcaagacaaacacaggcgctttgcaggctgctctgagggtctcagcccatcccccaggaggactgggatttggtatgatcaaatcctcaagccagctgggggcccaggctgaagacctggggacaggtcgattgctggaccagggcaaagaagaagccctgccatctgtgccctgtgggccttttccctggggcagcaccttgccctccccaggggatcactcacttgtcttctatgaagacggactcttcatgaggttgaatttcatgccagtttgtatttttataagtatctagaccaaaccttcaataaaccactcatctttttgttgccctccccaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]