GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-09-16 19:38:20, GGRNA.v2 : RefSeq release 231 (Jul, 2025)

LOCUS       NM_182690               1108 bp    mRNA    linear   PRI 27-APR-2025
DEFINITION  Homo sapiens ephrin A4 (EFNA4), transcript variant 3, mRNA.
ACCESSION   NM_182690
VERSION     NM_182690.3
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1108)
  AUTHORS   Yuan,W., Zhao,H., Zhou,A. and Wang,S.
  TITLE     Interference of EFNA4 suppresses cell proliferation, invasion and
            angiogenesis in hepatocellular carcinoma by downregulating PYGO2
  JOURNAL   Cancer Biol Ther 23 (1), 1-12 (2022)
   PUBMED   36404439
  REMARK    GeneRIF: Interference of EFNA4 suppresses cell proliferation,
            invasion and angiogenesis in hepatocellular carcinoma by
            downregulating PYGO2.
REFERENCE   2  (bases 1 to 1108)
  AUTHORS   Kousathanas,A., Pairo-Castineira,E., Rawlik,K., Stuckey,A.,
            Odhams,C.A., Walker,S., Russell,C.D., Malinauskas,T., Wu,Y.,
            Millar,J., Shen,X., Elliott,K.S., Griffiths,F., Oosthuyzen,W.,
            Morrice,K., Keating,S., Wang,B., Rhodes,D., Klaric,L., Zechner,M.,
            Parkinson,N., Siddiq,A., Goddard,P., Donovan,S., Maslove,D.,
            Nichol,A., Semple,M.G., Zainy,T., Maleady-Crowe,F., Todd,L.,
            Salehi,S., Knight,J., Elgar,G., Chan,G., Arumugam,P., Patch,C.,
            Rendon,A., Bentley,D., Kingsley,C., Kosmicki,J.A., Horowitz,J.E.,
            Baras,A., Abecasis,G.R., Ferreira,M.A.R., Justice,A., Mirshahi,T.,
            Oetjens,M., Rader,D.J., Ritchie,M.D., Verma,A., Fowler,T.A.,
            Shankar-Hari,M., Summers,C., Hinds,C., Horby,P., Ling,L.,
            McAuley,D., Montgomery,H., Openshaw,P.J.M., Elliott,P., Walsh,T.,
            Tenesa,A., Fawkes,A., Murphy,L., Rowan,K., Ponting,C.P., Vitart,V.,
            Wilson,J.F., Yang,J., Bretherick,A.D., Scott,R.H., Hendry,S.C.,
            Moutsianas,L., Law,A., Caulfield,M.J. and Baillie,J.K.
  CONSRTM   GenOMICC investigators; 23andMe investigators; COVID-19 Human
            Genetics Initiative
  TITLE     Whole-genome sequencing reveals host factors underlying critical
            COVID-19
  JOURNAL   Nature 607 (7917), 97-103 (2022)
   PUBMED   35255492
REFERENCE   3  (bases 1 to 1108)
  AUTHORS   Huttlin,E.L., Bruckner,R.J., Navarrete-Perea,J., Cannon,J.R.,
            Baltier,K., Gebreab,F., Gygi,M.P., Thornock,A., Zarraga,G., Tam,S.,
            Szpyt,J., Gassaway,B.M., Panov,A., Parzen,H., Fu,S., Golbazi,A.,
            Maenpaa,E., Stricker,K., Guha Thakurta,S., Zhang,T., Rad,R.,
            Pan,J., Nusinow,D.P., Paulo,J.A., Schweppe,D.K., Vaites,L.P.,
            Harper,J.W. and Gygi,S.P.
  TITLE     Dual proteome-scale networks reveal cell-specific remodeling of the
            human interactome
  JOURNAL   Cell 184 (11), 3022-3040 (2021)
   PUBMED   33961781
REFERENCE   4  (bases 1 to 1108)
  AUTHORS   Chen,Y.L., Yen,Y.C., Jang,C.W., Wang,S.H., Huang,H.T., Chen,C.H.,
            Hsiao,J.R., Chang,J.Y. and Chen,Y.W.
  TITLE     Ephrin A4-ephrin receptor A10 signaling promotes cell migration and
            spheroid formation by upregulating NANOG expression in oral
            squamous cell carcinoma cells
  JOURNAL   Sci Rep 11 (1), 644 (2021)
   PUBMED   33436772
  REMARK    GeneRIF: Ephrin A4-ephrin receptor A10 signaling promotes cell
            migration and spheroid formation by upregulating NANOG expression
            in oral squamous cell carcinoma cells.
            Publication Status: Online-Only
REFERENCE   5  (bases 1 to 1108)
  AUTHORS   Luck,K., Kim,D.K., Lambourne,L., Spirohn,K., Begg,B.E., Bian,W.,
            Brignall,R., Cafarelli,T., Campos-Laborie,F.J., Charloteaux,B.,
            Choi,D., Cote,A.G., Daley,M., Deimling,S., Desbuleux,A., Dricot,A.,
            Gebbia,M., Hardy,M.F., Kishore,N., Knapp,J.J., Kovacs,I.A.,
            Lemmens,I., Mee,M.W., Mellor,J.C., Pollis,C., Pons,C.,
            Richardson,A.D., Schlabach,S., Teeking,B., Yadav,A., Babor,M.,
            Balcha,D., Basha,O., Bowman-Colin,C., Chin,S.F., Choi,S.G.,
            Colabella,C., Coppin,G., D'Amata,C., De Ridder,D., De Rouck,S.,
            Duran-Frigola,M., Ennajdaoui,H., Goebels,F., Goehring,L., Gopal,A.,
            Haddad,G., Hatchi,E., Helmy,M., Jacob,Y., Kassa,Y., Landini,S.,
            Li,R., van Lieshout,N., MacWilliams,A., Markey,D., Paulson,J.N.,
            Rangarajan,S., Rasla,J., Rayhan,A., Rolland,T., San-Miguel,A.,
            Shen,Y., Sheykhkarimli,D., Sheynkman,G.M., Simonovsky,E., Tasan,M.,
            Tejeda,A., Tropepe,V., Twizere,J.C., Wang,Y., Weatheritt,R.J.,
            Weile,J., Xia,Y., Yang,X., Yeger-Lotem,E., Zhong,Q., Aloy,P.,
            Bader,G.D., De Las Rivas,J., Gaudet,S., Hao,T., Rak,J.,
            Tavernier,J., Hill,D.E., Vidal,M., Roth,F.P. and Calderwood,M.A.
  TITLE     A reference map of the human binary protein interactome
  JOURNAL   Nature 580 (7803), 402-408 (2020)
   PUBMED   32296183
REFERENCE   6  (bases 1 to 1108)
  AUTHORS   Zhou,R.
  TITLE     The Eph family receptors and ligands
  JOURNAL   Pharmacol Ther 77 (3), 151-181 (1998)
   PUBMED   9576626
  REMARK    Review article
REFERENCE   7  (bases 1 to 1108)
  AUTHORS   Flanagan,J.G. and Vanderhaeghen,P.
  TITLE     The ephrins and Eph receptors in neural development
  JOURNAL   Annu Rev Neurosci 21, 309-345 (1998)
   PUBMED   9530499
  REMARK    Review article
REFERENCE   8  (bases 1 to 1108)
  AUTHORS   Gale,N.W., Holland,S.J., Valenzuela,D.M., Flenniken,A., Pan,L.,
            Ryan,T.E., Henkemeyer,M., Strebhardt,K., Hirai,H., Wilkinson,D.G.,
            Pawson,T., Davis,S. and Yancopoulos,G.D.
  TITLE     Eph receptors and ligands comprise two major specificity subclasses
            and are reciprocally compartmentalized during embryogenesis
  JOURNAL   Neuron 17 (1), 9-19 (1996)
   PUBMED   8755474
REFERENCE   9  (bases 1 to 1108)
  AUTHORS   Cerretti,D.P., Lyman,S.D., Kozlosky,C.J., Copeland,N.G.,
            Gilbert,D.J., Jenkins,N.A., Valentine,V., Kirstein,M.N.,
            Shapiro,D.N. and Morris,S.W.
  TITLE     The genes encoding the eph-related receptor tyrosine kinase ligands
            LERK-1 (EPLG1, Epl1), LERK-3 (EPLG3, Epl3), and LERK-4 (EPLG4,
            Epl4) are clustered on human chromosome 1 and mouse chromosome 3
  JOURNAL   Genomics 33 (2), 277-282 (1996)
   PUBMED   8660976
REFERENCE   10 (bases 1 to 1108)
  AUTHORS   Kozlosky,C.J., Maraskovsky,E., McGrew,J.T., VandenBos,T., Teepe,M.,
            Lyman,S.D., Srinivasan,S., Fletcher,F.A., Gayle,R.B. 3rd,
            Cerretti,D.P. et al.
  TITLE     Ligands for the receptor tyrosine kinases hek and elk: isolation of
            cDNAs encoding a family of proteins
  JOURNAL   Oncogene 10 (2), 299-306 (1995)
   PUBMED   7838529
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from BM740848.1, AJ006353.1 and
            AL691442.32.
            
            On May 31, 2019 this sequence version replaced NM_182690.2.
            
            Summary: This gene encodes a member of the ephrin (EPH) family. The
            ephrins and EPH-related receptors comprise the largest subfamily of
            receptor protein-tyrosine kinases and have been implicated in
            mediating developmental events, especially in the nervous system
            and in erythropoiesis. Based on their structures and sequence
            relationships, ephrins are divided into the ephrin-A (EFNA) class,
            which are anchored to the membrane by a
            glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB)
            class, which are transmembrane proteins. This gene encodes an EFNA
            class ephrin that has been implicated in proliferation and
            metastasis of several types of cancers. [provided by RefSeq, May
            2022].
            
            Transcript Variant: This variant (3), also known as ephrin-A4 (s),
            uses an alternate splice site in the 3' coding region, compared to
            variant 1, that results in a downstream translation termination. It
            encodes isoform c which has a distinct and slightly shorter
            C-terminus compared to isoform a. Isoform c lacks a characteristic
            transmembrane domain and the GPI-signal sequence contained in
            isoform a. Isoform c is a secreted molecule.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AJ006353.1, DRR138513.144520.1
                                           [ECO:0000332]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            coronavirus related :: locus in the vicinity of disease-associated
                                   variant(s)
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-435               BM740848.1         4-438
            436-833             AJ006353.1         379-776
            834-1108            AL691442.32        17551-17825
FEATURES             Location/Qualifiers
     source          1..1108
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="1"
                     /map="1q21.3"
     gene            1..1108
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /note="ephrin A4"
                     /db_xref="GeneID:1945"
                     /db_xref="HGNC:HGNC:3224"
                     /db_xref="MIM:601380"
     exon            1..197
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /inference="alignment:Splign:2.1.0"
     variation       1
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1571648074"
     variation       2
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1056175760"
     variation       3
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:539593653"
     variation       4
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:949761401"
     variation       5
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526434714"
     variation       8
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526434733"
     variation       9
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1044174413"
     variation       10
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:905998730"
     variation       11
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:941502694"
     variation       12
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526434816"
     variation       13..15
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="t"
                     /replace="tgt"
                     /db_xref="dbSNP:1662879747"
     variation       13
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1464119917"
     variation       14
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1002230"
     variation       15
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526434877"
     variation       16
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1571648146"
     variation       17
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1170853712"
     variation       18
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369610690"
     variation       19
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526434979"
     variation       21..26
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="tc"
                     /replace="tctctc"
                     /db_xref="dbSNP:964695884"
     variation       21
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:2526434988"
     variation       22
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1182087715"
     variation       25
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2102437167"
     variation       26
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:897387079"
     variation       27
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526435060"
     variation       28
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1662881223"
     variation       29
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1558137938"
     variation       30
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:994855515"
     variation       32
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1662881720"
     variation       33
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526435123"
     variation       34
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1433143254"
     variation       35
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1662881992"
     variation       36..37
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace=""
                     /replace="ga"
                     /db_xref="dbSNP:2526435178"
     variation       36
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2526435169"
     variation       38
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526435185"
     variation       40
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1662882112"
     variation       41
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1322365129"
     variation       42
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1365659493"
     variation       43
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1051079881"
     variation       44
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1282376546"
     variation       45
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1358327937"
     variation       46..48
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="ggg"
                     /replace="gggg"
                     /db_xref="dbSNP:1181310223"
     variation       46
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1662883179"
     variation       47
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526435286"
     variation       48
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:955424484"
     variation       49
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1228436701"
     variation       51
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526435311"
     variation       52
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:750018113"
     variation       53..62
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="gccaggccag"
                     /replace="gccaggccaggccag"
                     /db_xref="dbSNP:1253948957"
     variation       53
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1463310416"
     variation       54
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:958220768"
     variation       55
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1248187187"
     variation       56
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526435387"
     variation       58
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526435398"
     variation       59..60
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:1662884907"
     variation       59
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1219973346"
     variation       60
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:988198140"
     variation       62
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:758048320"
     variation       64
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:779821500"
     variation       67
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:914050693"
     variation       68
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:2526435467"
     variation       69
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:946855865"
     variation       71
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1163962401"
     variation       72
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526435587"
     variation       73
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1411314602"
     variation       74
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:2526435611"
     variation       75
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1455908012"
     variation       77
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:746766754"
     variation       78..82
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="ggggg"
                     /replace="gggggg"
                     /db_xref="dbSNP:2526435664"
     variation       78
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1662886993"
     variation       81
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2526435677"
     variation       82
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526435696"
     variation       83
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526435709"
     variation       84
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1043928491"
     CDS             85..666
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /note="isoform c precursor is encoded by transcript
                     variant 3; ligand of eph-related kinase 4; eph-related
                     receptor tyrosine kinase ligand 4"
                     /codon_start=1
                     /product="ephrin-A4 isoform c precursor"
                     /protein_id="NP_872632.2"
                     /db_xref="CCDS:CCDS41407.1"
                     /db_xref="GeneID:1945"
                     /db_xref="HGNC:HGNC:3224"
                     /db_xref="MIM:601380"
                     /translation="
MRLLPLLRTVLWAAFLGSPLRGGSSLRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPHYEGPGPPEGPETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSLGFEFLPGETYYYISVPTPESSGQCLRLQVSVCCKERNLPSHPKEPESSQDPLEEEGSLLPALGVPIQTDKMEH"
     sig_peptide     85..150
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /inference="COORDINATES: ab initio prediction:SignalP:6.0"
     misc_feature    163..540
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /note="Ectodomain of Ephrin A; Region:
                     Ephrin-A_Ectodomain; cd10425"
                     /db_xref="CDD:259896"
     misc_feature    order(241..243,364..378,403..408,427..444,448..453)
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /note="receptor binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:259896"
     variation       85
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1662887221"
     variation       86
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526435765"
     variation       87
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:754852081"
     variation       88
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:926859436"
     variation       89
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2102437399"
     variation       90
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526435840"
     variation       92
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:938282528"
     variation       93
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2526435857"
     variation       94
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526435869"
     variation       95
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526435880"
     variation       96
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526435891"
     variation       98
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1448650572"
     variation       99
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1429093184"
     variation       100
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2102437421"
     variation       101
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1278509153"
     variation       102
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526435961"
     variation       104
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526435973"
     variation       105
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526435993"
     variation       106
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526436004"
     variation       107
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1326461416"
     variation       108
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:780960543"
     variation       109
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1553267248"
     variation       110
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:2526436060"
     variation       111
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526436072"
     variation       112
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1403415249"
     variation       113
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1662888815"
     variation       114
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526436110"
     variation       115
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:891128045"
     variation       116
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526436130"
     variation       117
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:12760718"
     variation       119
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526436171"
     variation       121
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1349674156"
     variation       122
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526436197"
     variation       123
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526436209"
     variation       124
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1006894326"
     variation       125
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1322354491"
     variation       126
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:111269205"
     variation       131
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526436266"
     variation       132
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1662889826"
     variation       133
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1254487338"
     variation       134
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:868405546"
     variation       135
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2526436323"
     variation       137
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1444693034"
     variation       138
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1662890317"
     variation       139
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526436384"
     variation       140
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:968141432"
     variation       142
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:771087028"
     variation       144
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1157743046"
     variation       145
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:2526436433"
     variation       146
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:865897803"
     variation       147
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:774589466"
     variation       148..152
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="gggg"
                     /replace="ggggg"
                     /db_xref="dbSNP:2526436480"
     variation       148
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526436462"
     variation       149
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1471660146"
     variation       150
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1184386171"
     variation       151
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1662891331"
     variation       152
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1413024884"
     variation       153
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1414009017"
     variation       154
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:746026404"
     variation       155
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:772406343"
     variation       156
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526436595"
     variation       157
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1033285451"
     variation       158
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1662892512"
     variation       159
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1197207739"
     variation       160
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:2526436645"
     variation       161
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1232431969"
     variation       162
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:2526436661"
     variation       163
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1414753641"
     variation       164
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1307352212"
     variation       165
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1348498880"
     variation       167
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:2526436717"
     variation       168
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1411162602"
     variation       169
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1662893318"
     variation       170
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:2526436776"
     variation       171
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:1558138217"
     variation       171
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526436789"
     variation       175
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:896160038"
     variation       176
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1662893722"
     variation       177
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1288397903"
     variation       178
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:543428198"
     variation       179
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526436863"
     variation       180
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526436873"
     variation       181
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:993214956"
     variation       183
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1230597690"
     variation       185..186
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:2526436912"
     variation       185
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2526436905"
     variation       186
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1254696715"
     variation       187
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1347586578"
     variation       188
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1201332848"
     variation       189
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:760930080"
     variation       190..191
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="aa"
                     /db_xref="dbSNP:1662894831"
     variation       191
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526436977"
     variation       192..195
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="cccc"
                     /replace="ccccc"
                     /db_xref="dbSNP:2526437124"
     variation       192
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:764545146"
     variation       193
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526437131"
     variation       194
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1227854348"
     variation       195
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:776966466"
     variation       197
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1290688935"
     exon            198..484
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /inference="alignment:Splign:2.1.0"
     variation       198
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1663054146"
     variation       205
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1391062717"
     variation       206
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:762225853"
     variation       207
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1663054383"
     variation       211
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:770282147"
     variation       213
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:773749190"
     variation       214
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:745549912"
     variation       216
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:146980401"
     variation       217
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:142249822"
     variation       220
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2526456384"
     variation       223
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526456390"
     variation       224
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526456399"
     variation       226
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1242749612"
     variation       227
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1663054982"
     variation       230
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526456425"
     variation       233
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1267281203"
     variation       235
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526456441"
     variation       236
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:927730429"
     variation       237
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369664889"
     variation       238
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:767156779"
     variation       242
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1571653198"
     variation       243
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:780175061"
     variation       244
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1341898292"
     variation       245
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526456514"
     variation       247
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2526456524"
     variation       250
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526456534"
     variation       251
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1215432400"
     variation       252..257
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="tg"
                     /replace="tgtctg"
                     /db_xref="dbSNP:1466098975"
     variation       253
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526456552"
     variation       255
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2526456561"
     variation       256
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526456569"
     variation       257
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526456579"
     variation       258..262
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="ccccc"
                     /replace="cccccc"
                     /db_xref="dbSNP:2526456593"
     variation       258
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526456585"
     variation       259
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:752523859"
     variation       261
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1663055861"
     variation       262
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:148289726"
     variation       263
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199992371"
     variation       265
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1166365914"
     variation       267
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:542869546"
     variation       268
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:780190233"
     variation       269
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526456664"
     variation       270
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526456673"
     variation       271
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2526456679"
     variation       274
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2526456697"
     variation       276
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526456701"
     variation       277..279
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="gg"
                     /replace="ggg"
                     /db_xref="dbSNP:2526456716"
     variation       277
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2102443103"
     variation       278
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370756589"
     variation       279
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:781461644"
     variation       280..284
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="ccccc"
                     /replace="cccccc"
                     /replace="ccccccc"
                     /db_xref="dbSNP:775997490"
     variation       280
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:199831867"
     variation       281
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199824664"
     variation       282
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:773661006"
     variation       283
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1663057149"
     variation       284..285
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace=""
                     /replace="ct"
                     /db_xref="dbSNP:2526456774"
     variation       284
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1553267556"
     variation       285..289
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace=""
                     /replace="tgagg"
                     /db_xref="dbSNP:1663057416"
     variation       285
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:764503763"
     variation       286
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2102443149"
     variation       287
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:2526456794"
     variation       287
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526456792"
     variation       288
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1663057497"
     variation       289
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526456808"
     variation       290
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1240867561"
     variation       292
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2526456824"
     variation       294
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:763481245"
     variation       295
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:770278541"
     variation       296
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:773922536"
     variation       298
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:754285540"
     variation       298
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:2526456860"
     variation       299
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201078911"
     variation       300
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:541082385"
     variation       306
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:2526456883"
     variation       309
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2102443179"
     variation       310
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1266496575"
     variation       312
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526456900"
     variation       313
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:138277393"
     variation       314..319
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="tgg"
                     /replace="tggtgg"
                     /db_xref="dbSNP:2526456924"
     variation       314
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1663058284"
     variation       315
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:760519955"
     variation       316
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526456945"
     variation       318
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1255181016"
     variation       319..323
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="gactg"
                     /db_xref="dbSNP:2526456958"
     variation       321
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:774979817"
     variation       324
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:753765092"
     variation       326
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:368247612"
     variation       327
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:778775987"
     variation       328
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:997960767"
     variation       329
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1179332137"
     variation       330
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:2526457031"
     variation       330
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1244820785"
     variation       331..333
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="t"
                     /replace="tat"
                     /replace="tatat"
                     /db_xref="dbSNP:1413766725"
     variation       333
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:370806650"
     variation       334
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201123791"
     variation       335
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1663059303"
     variation       336
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2102443247"
     variation       337
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:2526457094"
     variation       338
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:200677884"
     variation       339
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526457104"
     variation       340
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1663059534"
     variation       342
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1464802967"
     variation       344
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1359699711"
     variation       345
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375400864"
     variation       347
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1663060007"
     variation       349
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1663060083"
     variation       350
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="actcata"
                     /db_xref="dbSNP:1476256817"
     variation       351
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1663060334"
     variation       352..353
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace=""
                     /replace="ca"
                     /db_xref="dbSNP:1168173419"
     variation       353
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1431141714"
     variation       354..358
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="ccccc"
                     /replace="cccccc"
                     /db_xref="dbSNP:758089508"
     variation       354
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1004443861"
     variation       355
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:2526457212"
     variation       356
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1407731922"
     variation       358
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1558139918"
     variation       359..361
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="ggg"
                     /replace="gggg"
                     /db_xref="dbSNP:766100897"
     variation       359
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:142999275"
     variation       361
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526457323"
     variation       362
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1409322528"
     variation       364
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1286500741"
     variation       365
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1663061730"
     variation       366
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1663061841"
     variation       368
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1663061959"
     variation       369
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1352621818"
     variation       370
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:778114973"
     variation       371
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:749698866"
     variation       372
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1663062544"
     variation       373
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1310232406"
     variation       374..376
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="gg"
                     /replace="ggg"
                     /db_xref="dbSNP:1663062844"
     variation       376
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2526457499"
     variation       377
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:2526457517"
     variation       377
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:2526457508"
     variation       378
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1416250899"
     variation       380
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526457537"
     variation       381
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:544929070"
     variation       383..384
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="cc"
                     /replace="tt"
                     /db_xref="dbSNP:866104265"
     variation       387
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:953962875"
     variation       388..389
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="cc"
                     /replace="cctttcgctcc"
                     /db_xref="dbSNP:1663064354"
     variation       388
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1663064257"
     variation       391
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1280989380"
     variation       395
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2526457712"
     variation       399
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:774783548"
     variation       403
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:989804173"
     variation       405
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1663064628"
     variation       408
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1663064704"
     variation       409
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1663064781"
     variation       411
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:563226989"
     variation       414
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526457758"
     variation       416
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1663064999"
     variation       417
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:966768645"
     variation       420
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1253329399"
     variation       423..426
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="gc"
                     /replace="gcgc"
                     /db_xref="dbSNP:2526457788"
     variation       424
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368795287"
     variation       425
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:775247787"
     variation       426
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526457821"
     variation       431
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1422554226"
     variation       432
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1663065651"
     variation       433..435
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="ccc"
                     /replace="cccc"
                     /db_xref="dbSNP:2526457861"
     variation       433
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:143886639"
     variation       434
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1663065922"
     variation       439
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:776556253"
     variation       440
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1256233082"
     variation       441
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526457889"
     variation       444
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:761582524"
     variation       445
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:765191806"
     variation       447
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:750377879"
     variation       450
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1372491408"
     variation       453
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2526457925"
     variation       456
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:114301457"
     variation       458
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526457948"
     variation       459
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:767615043"
     variation       460
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1365701872"
     variation       463..464
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="gg"
                     /db_xref="dbSNP:1220776337"
     variation       464..469
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="gaga"
                     /replace="gagaga"
                     /db_xref="dbSNP:2526457990"
     variation       464
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526457981"
     variation       469..475
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="act"
                     /replace="acttact"
                     /db_xref="dbSNP:2526458000"
     variation       469
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1663067062"
     variation       470
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:752848379"
     variation       471
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526458019"
     variation       473
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="aa"
                     /db_xref="dbSNP:2526458040"
     variation       473
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1291203787"
     variation       474
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1341436553"
     variation       475
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1663067363"
     variation       476
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:756341656"
     variation       477
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:778025181"
     variation       478
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526458134"
     variation       479
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1663067981"
     variation       480
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2102443491"
     variation       482
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1437922306"
     variation       484
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1663068132"
     exon            485..553
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /inference="alignment:Splign:2.1.0"
     variation       485
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1213932996"
     variation       486
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:151179474"
     variation       487
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1663077376"
     variation       489
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526459832"
     variation       492
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:41264287"
     variation       493
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1464742957"
     variation       495
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526459886"
     variation       496
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526459895"
     variation       497
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526459905"
     variation       499
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1187019544"
     variation       501
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:764267914"
     variation       502..504
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace=""
                     /replace="agt"
                     /db_xref="dbSNP:2526459937"
     variation       503
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526459945"
     variation       505..506
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace=""
                     /replace="gggca"
                     /db_xref="dbSNP:2526459950"
     variation       506
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201670234"
     variation       508
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526459962"
     variation       509
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2102443869"
     variation       513
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:757589642"
     variation       515
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1663077888"
     variation       517
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:141223577"
     variation       519
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:908106668"
     variation       521
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:746332488"
     variation       522
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142288768"
     variation       524
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526460030"
     variation       525
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1463020576"
     variation       528
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1663078385"
     variation       529
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2526460058"
     variation       530
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1663078450"
     variation       533
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526460074"
     variation       534..536
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="t"
                     /replace="tgt"
                     /db_xref="dbSNP:1241165316"
     variation       534
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="t"
                     /replace="tt"
                     /db_xref="dbSNP:1663078516"
     variation       535
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:780776065"
     variation       537
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:746489131"
     variation       538
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1447360049"
     variation       539
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:768333356"
     variation       543
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526460121"
     variation       547
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:780848551"
     variation       551
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526460181"
     variation       552
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526460198"
     exon            554..1108
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /inference="alignment:Splign:2.1.0"
     variation       555..556
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:760995989"
     variation       555
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1384413083"
     variation       556
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199947288"
     variation       559
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2526465665"
     variation       560
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1339957778"
     variation       561..565
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="ctc"
                     /replace="ctctc"
                     /db_xref="dbSNP:1558141164"
     variation       561
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1017969863"
     variation       562
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526465687"
     variation       563
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:567168153"
     variation       564
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2102445596"
     variation       565
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1553267703"
     variation       568
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:201215681"
     variation       570
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:758266087"
     variation       571
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1663119483"
     variation       575
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526465740"
     variation       576
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:2526465749"
     variation       576
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:779807669"
     variation       578
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:202246914"
     variation       579
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:773440754"
     variation       580
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2526465768"
     variation       581
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:749132073"
     variation       581
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1663119892"
     variation       582
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1558141212"
     variation       583..590
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace=""
                     /replace="tcctccca"
                     /db_xref="dbSNP:771046983"
     variation       585
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1663120130"
     variation       587
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526465814"
     variation       588
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526465821"
     variation       589
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526465828"
     variation       590
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:749435869"
     variation       591
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:771274591"
     variation       595
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526465857"
     variation       598..599
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace=""
                     /replace="ca"
                     /db_xref="dbSNP:774703301"
     variation       599
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:1558141229"
     variation       599
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:774753006"
     variation       603
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1663120523"
     variation       605
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1553267706"
     variation       606..607
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="gg"
                     /db_xref="dbSNP:746080148"
     variation       610
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:759796184"
     variation       611
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2526465926"
     variation       613
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526465932"
     variation       614
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1472051023"
     variation       616
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1158978226"
     variation       617
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:767943701"
     variation       620
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1455615031"
     variation       621
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:889300332"
     variation       625
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:775818108"
     variation       627
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1170496887"
     variation       629
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="t"
                     /replace="tt"
                     /db_xref="dbSNP:2526465989"
     variation       630..634
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="ggggg"
                     /replace="gggggg"
                     /db_xref="dbSNP:772130989"
     variation       631
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526466014"
     variation       633
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526466021"
     variation       634
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526466028"
     variation       635
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1402072773"
     variation       636
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2102445698"
     variation       639..640
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace=""
                     /replace="aa"
                     /db_xref="dbSNP:775733013"
     variation       640
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1571655799"
     variation       643
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:761244893"
     variation       644
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:763533997"
     variation       646
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:2526466095"
     variation       647
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1663121737"
     variation       648
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1228015744"
     variation       649
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1021875220"
     variation       651
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:748113318"
     variation       652
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526466141"
     variation       653
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1663122081"
     variation       656
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526466152"
     variation       657..658
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="gg"
                     /db_xref="dbSNP:1216183664"
     variation       658
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1663122196"
     variation       663
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:772048174"
     variation       666
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526466214"
     variation       668
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1484635748"
     variation       670
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2526466235"
     variation       672
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:761356922"
     variation       674
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:552355758"
     variation       675
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1031690866"
     variation       677
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:960070810"
     variation       681
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:750115905"
     variation       684
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526466274"
     variation       687
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:758090033"
     variation       688
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:2526466284"
     variation       690
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526466297"
     variation       691
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526466300"
     variation       694..697
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="ct"
                     /replace="ctct"
                     /db_xref="dbSNP:2526466312"
     variation       695
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:2526466320"
     variation       698
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:916014726"
     variation       699
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1472197427"
     variation       700
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:779905284"
     variation       701
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1421280494"
     variation       703
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1553267728"
     variation       704
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1160251060"
     variation       706
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:570670486"
     variation       709
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:915184543"
     variation       711
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1314920375"
     variation       713..716
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="cctc"
                     /db_xref="dbSNP:2526466410"
     variation       714
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2526466417"
     variation       716
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1663123547"
     variation       717
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1158480020"
     variation       718
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2102445821"
     variation       719
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1663123675"
     variation       720
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526466458"
     variation       721
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2526466467"
     variation       723
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1558141354"
     variation       724
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526466486"
     variation       728..734
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="aaga"
                     /replace="aagaaga"
                     /db_xref="dbSNP:761223567"
     variation       729
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1409227720"
     variation       735
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526466517"
     variation       736
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:751395056"
     variation       738
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526466538"
     variation       740
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1663124021"
     variation       742
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1375754714"
     variation       745
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1204969278"
     variation       746
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:754953222"
     variation       747
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:781344227"
     variation       749
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526466585"
     variation       750
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2526466591"
     variation       751
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1345719917"
     variation       753
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:749345800"
     variation       754
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526466629"
     variation       755..758
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="ct"
                     /replace="ctct"
                     /db_xref="dbSNP:1226859582"
     variation       755
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1382096108"
     variation       758
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526466647"
     variation       759..774
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="gaagcagaggcaagac"
                     /replace="gaagcagaggcaagacgaagcagaggcaagac"
                     /db_xref="dbSNP:2526466651"
     variation       761
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526466658"
     variation       767
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1280886339"
     variation       768
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:771183074"
     variation       769
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:779226711"
     variation       771
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1663124751"
     variation       772
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:746129864"
     variation       773
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526466706"
     variation       774
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1057273721"
     variation       777..781
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="aca"
                     /replace="acaca"
                     /db_xref="dbSNP:764734484"
     variation       780
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1663125039"
     variation       784
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:981034397"
     variation       785
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:909117055"
     variation       786
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1663125260"
     variation       788
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1162226299"
     variation       792
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526466815"
     variation       793
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2526466823"
     variation       794
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1404452992"
     variation       799
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2102445922"
     variation       800
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:2526466834"
     variation       805
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526466841"
     variation       806
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:897335499"
     variation       807
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1571655973"
     variation       811
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:941954387"
     variation       813
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526466864"
     variation       814
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526466868"
     variation       815
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526466875"
     variation       818
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526466880"
     variation       819
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:112399433"
     variation       820
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1571655986"
     variation       821
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1663125748"
     variation       822
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1663125800"
     variation       823
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:2526466939"
     variation       827
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526466942"
     variation       828
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526466949"
     variation       830..831
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace=""
                     /replace="ct"
                     /db_xref="dbSNP:1237514676"
     variation       830
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1663125846"
     variation       831
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:888731911"
     variation       832
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:538384115"
     variation       833
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1006507102"
     variation       835
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526466971"
     variation       836
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526466981"
     variation       837
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526466985"
     variation       838
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526466991"
     variation       841
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526466996"
     variation       842
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526467002"
     variation       843
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:2526467010"
     variation       846
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526467013"
     variation       847
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:2526467017"
     variation       849
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:144763497"
     variation       850
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:2526467025"
     variation       853
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1663126180"
     variation       855
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1219627836"
     variation       856
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1663126295"
     variation       857
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1359075712"
     variation       859
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526467055"
     variation       860
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:2526467062"
     variation       862
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1292506153"
     variation       865..869
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="gggg"
                     /replace="ggggg"
                     /db_xref="dbSNP:2526467091"
     variation       865
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2102445976"
     variation       867
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1663126528"
     variation       868
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1348896353"
     variation       870..872
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="cc"
                     /replace="ccc"
                     /db_xref="dbSNP:2526467115"
     variation       873
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1213257771"
     variation       874
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1283668970"
     variation       875..876
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace=""
                     /replace="tcttcagcctgggc"
                     /db_xref="dbSNP:2526467140"
     variation       876
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1663126882"
     variation       880
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1487835650"
     variation       883
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526467169"
     variation       884
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1663127059"
     variation       886
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:897500547"
     variation       889
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1663127195"
     variation       892
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:563813867"
     variation       893
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526467277"
     variation       894
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:773104614"
     variation       895
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2102446017"
     variation       896
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1663127485"
     variation       896
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1051454441"
     variation       897
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:374633006"
     variation       899
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1663127614"
     variation       900
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526467357"
     variation       903
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1365820826"
     variation       904
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526467401"
     variation       906
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526467408"
     variation       907..908
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:2526467415"
     variation       908
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:2526467417"
     variation       909
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1164880029"
     variation       910
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1417352065"
     variation       911
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526467434"
     variation       913
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:2526467441"
     variation       915..923
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="aagaag"
                     /replace="aagaagaag"
                     /db_xref="dbSNP:1379195799"
     variation       917
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:888902933"
     variation       921
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:956725684"
     variation       923
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526467468"
     variation       924..926
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="cc"
                     /replace="ccc"
                     /db_xref="dbSNP:989364734"
     variation       925
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1007708289"
     variation       926..927
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace=""
                     /replace="aggct"
                     /db_xref="dbSNP:1663128192"
     variation       928
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1190413930"
     variation       930
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1022239988"
     variation       931
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:2526467527"
     variation       931
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2526467522"
     variation       933
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1455348952"
     variation       939
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:969296951"
     variation       941
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="t"
                     /replace="tt"
                     /db_xref="dbSNP:1663128555"
     variation       942
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:904745993"
     variation       943
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526467642"
     variation       947
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1224767589"
     variation       949..952
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="ttt"
                     /replace="tttt"
                     /db_xref="dbSNP:2526467657"
     variation       949
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1663128731"
     variation       954
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526467660"
     variation       956
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1487333217"
     variation       957
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526467671"
     variation       960
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:759728514"
     variation       963
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2526467680"
     variation       964
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:2526467689"
     variation       966
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1156430098"
     variation       970
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:1663129224"
     variation       970
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:564877955"
     variation       973
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1663129286"
     variation       974
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526467724"
     variation       975
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526467730"
     variation       978
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1663129334"
     variation       982
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1240377298"
     variation       983
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1319327545"
     variation       986
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:2526467758"
     variation       987
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1663129495"
     variation       988
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1663129542"
     variation       990
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:775819390"
     variation       991..994
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace=""
                     /replace="actt"
                     /db_xref="dbSNP:1223300097"
     variation       991
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:927294280"
     variation       992
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1663129834"
     variation       1000
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1663129924"
     variation       1001
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1304546371"
     variation       1002
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1663130022"
     variation       1007
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2526467833"
     variation       1009
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:769750020"
     variation       1010..1011
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="gg"
                     /db_xref="dbSNP:1663130253"
     variation       1010
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:536226496"
     variation       1013
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526467866"
     variation       1014
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526467876"
     variation       1021
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1663130312"
     variation       1038
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1455222047"
     variation       1042
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1663130422"
     variation       1043
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1375872284"
     variation       1047..1051
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="tttt"
                     /replace="ttttt"
                     /db_xref="dbSNP:2526467909"
     variation       1052
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1057458627"
     variation       1053
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1663130596"
     variation       1054
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526467952"
     variation       1056
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1663130642"
     variation       1057
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:554241024"
     variation       1060
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1663130752"
     variation       1062
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1663130822"
     variation       1063
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1175030350"
     variation       1064
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1663130949"
     variation       1065
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1480659387"
     variation       1068
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:2526468004"
     variation       1069
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1663131048"
     variation       1070
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:573097675"
     regulatory      1075..1080
                     /regulatory_class="polyA_signal_sequence"
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /note="hexamer: AATAAA"
     variation       1075
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1663131335"
     variation       1076
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1663131390"
     variation       1077
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:930126542"
     variation       1078
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1476999346"
     variation       1081
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1261129343"
     variation       1089
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1663131754"
     variation       1091
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1663131849"
     variation       1093..1098
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="ttg"
                     /replace="ttgttg"
                     /db_xref="dbSNP:1663131940"
     variation       1104
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:2526468095"
     variation       1105
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:540427499"
     variation       1107
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:2526468111"
     polyA_site      1108
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /note="major polyA site"
     variation       1108
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1325361549"
ORIGIN      
ccctcttcactttgtacctttctctcctcgactgtgaagcgggccgggacctgccaggccagaccaaaccggacctcgggggcgatgcggctgctgcccctgctgcggactgtcctctgggccgcgttcctcggctcccctctgcgcgggggctccagcctccgccacgtagtctactggaactccagtaaccccaggttgcttcgaggagacgccgtggtggagctgggcctcaacgattacctagacattgtctgcccccactacgaaggcccagggccccctgagggccccgagacgtttgctttgtacatggtggactggccaggctatgagtcctgccaggcagagggcccccgggcctacaagcgctgggtgtgctccctgccctttggccatgttcaattctcagagaagattcagcgcttcacacccttctccctcggctttgagttcttacctggagagacttactactacatctcggtgcccactccagagagttctggccagtgcttgaggctccaggtgtctgtctgctgcaaggagaggaaccttccctctcatcccaaggagccagagtcctcccaagatcccctggaggaggagggatccctgctgcctgcactgggggtgccaattcagaccgacaagatggagcattgatgggggagatcagagggtctgaggtgactcttgcaggagcctgtcccctcatcacaggctaaagaagagcagtagacagccctggacactctgaagcagaggcaagacaaacacaggcgctttgcaggctgctctgagggtctcagcccatcccccaggaggactgggatttggtatgatcaaatcctcaagccagctgggggcccaggctgaagacctggggacaggtcgattgctggaccagggcaaagaagaagccctgccatctgtgccctgtgggccttttccctggggcagcaccttgccctccccaggggatcactcacttgtcttctatgaagacggactcttcatgaggttgaatttcatgccagtttgtatttttataagtatctagaccaaaccttcaataaaccactcatctttttgttgccctccccaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]