GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2019-03-25 14:31:35, GGRNA.v2 : RefSeq release 92 (Jan, 2019)

LOCUS       NM_182653               1828 bp    mRNA    linear   MAM 09-DEC-2018
DEFINITION  Bos taurus retina and anterior neural fold homeobox 2 (RAX2), mRNA.
ACCESSION   NM_182653
VERSION     NM_182653.1
KEYWORDS    RefSeq.
SOURCE      Bos taurus (cattle)
  ORGANISM  Bos taurus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;
            Pecora; Bovidae; Bovinae; Bos.
REFERENCE   1  (bases 1 to 1828)
  AUTHORS   Zimin AV, Delcher AL, Florea L, Kelley DR, Schatz MC, Puiu D,
            Hanrahan F, Pertea G, Van Tassell CP, Sonstegard TS, Marcais G,
            Roberts M, Subramanian P, Yorke JA and Salzberg SL.
  TITLE     A whole-genome assembly of the domestic cow, Bos taurus
  JOURNAL   Genome Biol. 10 (4), R42 (2009)
   PUBMED   19393038
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AY211276.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AY211276.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN03145474 [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1828
                     /organism="Bos taurus"
                     /mol_type="mRNA"
                     /db_xref="taxon:9913"
                     /chromosome="7"
                     /map="7"
     gene            1..1828
                     /gene="RAX2"
                     /gene_synonym="QRX"
                     /note="retina and anterior neural fold homeobox 2"
                     /db_xref="BGD:BT18010"
                     /db_xref="GeneID:359713"
                     /db_xref="VGNC:VGNC:33767"
     CDS             49..603
                     /gene="RAX2"
                     /gene_synonym="QRX"
                     /note="Q50-type retinal homeobox protein; retina and
                     anterior neural fold homeobox-like protein 1"
                     /codon_start=1
                     /product="retina and anterior neural fold homeobox protein
                     2"
                     /protein_id="NP_872594.1"
                     /db_xref="BGD:BT18010"
                     /db_xref="GeneID:359713"
                     /db_xref="VGNC:VGNC:33767"
                     /translation="
MFLSPGEGPAAEGGGPGPGEEAPKKKHRRNRTTFTTYQLHQLERAFEASHYPDVYSREELAAKVHLPEVRVQVWFQNRRAKWRRQERLESGSGAVAAPRLPEVPALPFARPPTMPLSLEPWLGPGPPAVPALPRLLGSGPGLQGSFGPHAFSPAFMDGFTLEEGSLRLLAKEHVQALDRAWPSA"
     misc_feature    127..306
                     /gene="RAX2"
                     /gene_synonym="QRX"
                     /note="Region: homeobox domain"
     misc_feature    order(130..144,148..150,199..201,217..219,256..258,
                     262..267,274..279,283..291,295..300)
                     /gene="RAX2"
                     /gene_synonym="QRX"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(136..138,145..147,265..267,274..279,286..288)
                     /gene="RAX2"
                     /gene_synonym="QRX"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    139..297
                     /gene="RAX2"
                     /gene_synonym="QRX"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:278475"
ORIGIN      
cggcacgagagtgagcactgggcagccaggtgggggcaaggaggagccatgttcctgagcccaggtgaggggccggcggctgagggtggggggccagggcccggagaggaggcccccaagaagaagcaccggaggaaccgcacaacctttaccacgtaccagctgcaccagctggagcgggcgttcgaggcctcccactacccggacgtttacagccgtgaggagctggcagccaaggtgcacctgcccgaggtgcgcgtgcaggtgtggttccagaaccgccgggccaagtggcgccgccaggagcgtctggagtccggctctggggccgtggcagccccaagactccctgaggtcccagcactgccctttgcccgccctcccaccatgccactgtccctggagccctggctgggcccagggcccccagctgtgccagccctcccacgcctcctgggctcgggcccagggttgcagggctcctttgggccccacgccttcagtccagccttcatggatggcttcaccctggaggagggttccctgcggcttctggccaaggagcacgtgcaggctctggacagggcctggccgtcggcctgagcctggtgcctgcccagcccctcctgctcagcctgtccatggccacccacaccaagtcccccacccaccaccacctacccctgccttgcagggttaactggcactgacttcaaggtggcagccagaggcgcccagccagggtgggggtccctggcctggtctccccacctgtcaaatgggtgtgtggggtgggttctgaggttcttaaggctctacggctgtaaccaggagccacagggatgttaattctgagttgatcattctaaatcctcctgcctgctcctaagtgttcaacggcagggccgccctgagagataacaatagctgcagcagttcacattaactgccccctttcactgtgtgctcccagcatgcctatcagtgtaccccaaggtggcatggccatcagccccacgttacaggagaagaaactgaggcccagagagggatagtcagtttactcaggccacagagccagtagagggtggagctctttttaggctcattgcctgactccatcacccctggcgcctaggacccaggccgggcgctaacagggcgctcccaggcagaagcagctgacactggctgaacagtcgatctttgctccccccatttatcagagcgtggcttgtctcatcaaccacagcccccatcacatctcccagcccactgaggcggggctggggccctggtagcaagacaagcgttggttctgtccaaccacgtgcccccagggctcacaaaggcatgatggccgcccctgccggggttcaactgggctccaggacaatgaggctggctgggctggggggtgtggcccaagtgcccacatgtcaaggcacctccctgtgggatgggatgagtcaggaccggagagtgtatggtggggggggggggacatggcagcaccccagttactccaggctctggccaggaagtgaccacaggtgctaggaaattccaggaatgtcgcttccaggccactctcagctggcctgctcacctcccatctcagagggcacctcacgtgaaccccagcggcccctgtgtggtttatgctgcggcagcgaggccaaccatccccccaatcattcatccaccggttccaacttacgaggacacaacagtgaacaaagcagagaaaatcccctgccctcctggagctgccactccagtgggagagaccagtgccctaactttaaaaataaataagtaaaacgtg
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]