ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-04-20 21:20:48, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS NM_020293 1443 bp mRNA linear ROD 20-JUN-2025 DEFINITION Mus musculus claudin 9 (Cldn9), mRNA. ACCESSION NM_020293 VERSION NM_020293.3 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 1443) AUTHORS Adams,D.J., Barlas,B., McIntyre,R.E., Salguero,I., van der Weyden,L., Barros,A., Vicente,J.R., Karimpour,N., Haider,A., Ranzani,M., Turner,G., Thompson,N.A., Harle,V., Olvera-Leon,R., Robles-Espinoza,C.D., Speak,A.O., Geisler,N., Weninger,W.J., Geyer,S.H., Hewinson,J., Karp,N.A., Fu,B., Yang,F., Kozik,Z., Choudhary,J., Yu,L., van Ruiten,M.S., Rowland,B.D., Lelliott,C.J., Del Castillo Velasco-Herrera,M., Verstraten,R., Bruckner,L., Henssen,A.G., Rooimans,M.A., de Lange,J., Mohun,T.J., Arends,M.J., Kentistou,K.A., Coelho,P.A., Zhao,Y., Zecchini,H., Perry,J.R.B., Jackson,S.P. and Balmus,G. CONSRTM Sanger Mouse Genetics Project TITLE Genetic determinants of micronucleus formation in vivo JOURNAL Nature 627 (8002), 130-136 (2024) PUBMED 38355793 REFERENCE 2 (bases 1 to 1443) AUTHORS de Lemos,L., Dias,A., Novoa,A. and Mallo,M. TITLE Epha1 is a cell-surface marker for the neuromesodermal competent population JOURNAL Development 149 (6) (2022) PUBMED 35299237 REFERENCE 3 (bases 1 to 1443) AUTHORS Higashi,A.Y., Higashi,T., Furuse,K., Ozeki,K., Furuse,M. and Chiba,H. TITLE Claudin-9 constitutes tight junctions of folliculo-stellate cells in the anterior pituitary gland JOURNAL Sci Rep 11 (1), 21642 (2021) PUBMED 34737342 REMARK GeneRIF: Claudin-9 constitutes tight junctions of folliculo-stellate cells in the anterior pituitary gland. Publication Status: Online-Only REFERENCE 4 (bases 1 to 1443) AUTHORS Ramzan,M., Philippe,C., Belyantseva,I.A., Nakano,Y., Fenollar-Ferrer,C., Tona,R., Yousaf,R., Basheer,R., Imtiaz,A., Faridi,R., Munir,Z., Idrees,H., Salman,M., Nambot,S., Vitobello,A., Kartti,S., Zarrik,O., Witmer,P.D., Sobreria,N., Ibrahimi,A., Banfi,B., Moutton,S., Friedman,T.B. and Naz,S. TITLE Variants of human CLDN9 cause mild to profound hearing loss JOURNAL Hum Mutat 42 (10), 1321-1335 (2021) PUBMED 34265170 REFERENCE 5 (bases 1 to 1443) AUTHORS Du,T.T., Dewey,J.B., Wagner,E.L., Cui,R., Heo,J., Park,J.J., Francis,S.P., Perez-Reyes,E., Guillot,S.J., Sherman,N.E., Xu,W., Oghalai,J.S., Kachar,B. and Shin,J.B. TITLE LMO7 deficiency reveals the significance of the cuticular plate for hearing function JOURNAL Nat Commun 10 (1), 1117 (2019) PUBMED 30850599 REMARK Publication Status: Online-Only REFERENCE 6 (bases 1 to 1443) AUTHORS Abuazza,G., Becker,A., Williams,S.S., Chakravarty,S., Truong,H.T., Lin,F. and Baum,M. TITLE Claudins 6, 9, and 13 are developmentally expressed renal tight junction proteins JOURNAL Am J Physiol Renal Physiol 291 (6), F1132-F1141 (2006) PUBMED 16774906 REMARK GeneRIF: developmentally expressed claudin isoforms include claudin 6, claudin 9, and claudin 13 REFERENCE 7 (bases 1 to 1443) AUTHORS Hashizume,A., Ueno,T., Furuse,M., Tsukita,S., Nakanishi,Y. and Hieda,Y. TITLE Expression patterns of claudin family of tight junction membrane proteins in developing mouse submandibular gland JOURNAL Dev Dyn 231 (2), 425-431 (2004) PUBMED 15366020 REFERENCE 8 (bases 1 to 1443) AUTHORS Kitajiri,S.I., Furuse,M., Morita,K., Saishin-Kiuchi,Y., Kido,H., Ito,J. and Tsukita,S. TITLE Expression patterns of claudins, tight junction adhesion molecules, in the inner ear JOURNAL Hear Res 187 (1-2), 25-34 (2004) PUBMED 14698084 REMARK GeneRIF: Claudin-9 is expressed at the variety of epithelial tissues in inner ear including Organ of Corti, stria vascularis, Reissner's membrane, spiral limbus, vestibular sensory epithelia, and dark cell area. REFERENCE 9 (bases 1 to 1443) AUTHORS Turksen,K. and Troy,T.C. TITLE Permeability barrier dysfunction in transgenic mice overexpressing claudin 6 JOURNAL Development 129 (7), 1775-1784 (2002) PUBMED 11923212 REFERENCE 10 (bases 1 to 1443) AUTHORS Morita,K., Sasaki,H., Fujimoto,K., Furuse,M. and Tsukita,S. TITLE Claudin-11/OSP-based tight junctions of myelin sheaths in brain and Sertoli cells in testis JOURNAL J Cell Biol 145 (3), 579-588 (1999) PUBMED 10225958 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AC154766.2. On Aug 6, 2010 this sequence version replaced NM_020293.2. Summary: This intronless gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. This gene is developmentally regulated; it is expressed in neonate kidney, but disappers by adulthood. It is required for the preservation of sensory cells in the hearing organ and the gene deficiency is associated with deafness. [provided by RefSeq, Aug 2010]. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript is intronless :: BC058186.1 [ECO:0000345] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1443 AC154766.2 9094-10536 FEATURES Location/Qualifiers source 1..1443 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6" /db_xref="taxon:10090" /chromosome="17" /map="17 11.99 cM" gene 1..1443 /gene="Cldn9" /gene_synonym="nmf329" /note="claudin 9" /db_xref="GeneID:56863" /db_xref="MGI:MGI:1913100" exon 1..1443 /gene="Cldn9" /gene_synonym="nmf329" /inference="alignment:Splign:2.1.0" misc_feature 267..269 /gene="Cldn9" /gene_synonym="nmf329" /note="upstream in-frame stop codon" CDS 378..1031 /gene="Cldn9" /gene_synonym="nmf329" /codon_start=1 /product="claudin-9" /protein_id="NP_064689.2" /db_xref="CCDS:CCDS28458.1" /db_xref="GeneID:56863" /db_xref="MGI:MGI:1913100" /translation="
MASTGLELLGMTLAVLGWLGTLVSCALPLWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVVALLLALLGLLVAITGAQCTTCVEDEGAKARIVLTAGVLLLLSGILVLIPVCWTAHAIIQDFYNPLVAEALKRELGASLYLGWAAAALLMLGGGLLCCTCPPSHFERPRGPRLGYSIPSRSGASGLDKRDYV"
misc_feature 387..866
/gene="Cldn9"
/gene_synonym="nmf329"
/note="PMP-22/EMP/MP20/Claudin family; Region:
PMP22_Claudin; cl21598"
/db_xref="CDD:473919"
misc_feature 414..476
/gene="Cldn9"
/gene_synonym="nmf329"
/note="propagated from UniProtKB/Swiss-Prot (Q9Z0S7.2);
transmembrane region"
misc_feature 621..683
/gene="Cldn9"
/gene_synonym="nmf329"
/note="propagated from UniProtKB/Swiss-Prot (Q9Z0S7.2);
transmembrane region"
misc_feature 726..788
/gene="Cldn9"
/gene_synonym="nmf329"
/note="propagated from UniProtKB/Swiss-Prot (Q9Z0S7.2);
transmembrane region"
misc_feature 855..917
/gene="Cldn9"
/gene_synonym="nmf329"
/note="propagated from UniProtKB/Swiss-Prot (Q9Z0S7.2);
transmembrane region"
regulatory 1422..1427
/regulatory_class="polyA_signal_sequence"
/gene="Cldn9"
/gene_synonym="nmf329"
/note="hexamer: AATAAA"
polyA_site 1443
/gene="Cldn9"
/gene_synonym="nmf329"
/note="major polyA site"
ORIGIN
agacgtcccaagtggcacctcacggttccctgttttgagacaagctgtataccagctgagagaagacttcaaccaagaaagtacgtgagcagccagcagagaggaacgcggttgttcctagttcatggcagatctggaggggctgtaatgggtgaaggcttccaggaggacacaagcaatacagatgagcgggacctaaggacttcttcgtattcagtgagtaccagatgtgtgagaggcccgcagctgtgaggtctggcctggtctgagatcaacagatccccctcctgagcagtgagacgcacccgaactccaacacagtgctcccaaccctattgagtgattcaggccaagagctgagaagacccgaggagcagatggcttccactggccttgaactcctcggcatgaccctggctgtgctaggctggctaggaactttggtgtcctgtgccctgccactgtggaaggtgaccgccttcatcggcaacagcatcgttgtggcccaagtggtatgggaggggctgtggatgtcctgtgtggtccagagcactggccagatgcagtgcaaagtatacgactcactgctggcgctgccccaggacctgcaggcagccagagccctctgtgtcgtggccctcctgctggctttgctgggcctgctggtggctatcacgggcgcccagtgcaccacgtgtgtggaggacgaaggtgccaaggcccgtatcgtactcaccgcaggggtcctcctcctcctctcgggcattttggtgctcatccctgtctgctggacagcccatgccatcatccaggatttttataacccactggttgcggaagccctcaagagagaactgggggcttccctctacctgggctgggctgccgctgccctgctcatgctagggggagggctcctctgctgtacgtgtcccccgtcacactttgagcgtccccgcggccccaggctgggctactccatcccttcccgttcaggtgcttcgggactggataagagggactatgtgtgaggctgaggcttcttccagaagcttccacctgcggcttcatgccctgcattgggctacatccttatatcatcaaatccatgcgcctgcgaagctcacttattggccaggacttggctcttaggggatctcagctggtctggcttgagctaaccctctgtagtggttgcaaccttgagaaagctccagttactgggtaccctgcttatcgctgcctcccaggattttgctgtggtttgctctcctggactttcttactctggaacctggacctcagcctccttgccttcaaagtaagatgtggactgtgacctaatactgaggctttagctggtcaagtctagcccaagcaccacctgaatccaagttactcagccccctaccctacctgtgaataaaagcacattgtaactga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]