GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-03-30 00:06:08, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_019500               1475 bp    mRNA    linear   ROD 07-AUG-2023
DEFINITION  Mus musculus claudin 14 (Cldn14), transcript variant 1, mRNA.
ACCESSION   NM_019500
VERSION     NM_019500.4
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 1475)
  AUTHORS   Higashi AY, Higashi T, Furuse K, Ozeki K, Furuse M and Chiba H.
  TITLE     Claudin-9 constitutes tight junctions of folliculo-stellate cells
            in the anterior pituitary gland
  JOURNAL   Sci Rep 11 (1), 21642 (2021)
   PUBMED   34737342
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1475)
  AUTHORS   Frische S, Alexander RT, Ferreira P, Tan RSG, Wang W, Svenningsen
            P, Skjodt K and Dimke H.
  TITLE     Localization and regulation of claudin-14 in experimental models of
            hypercalcemia
  JOURNAL   Am J Physiol Renal Physiol 320 (1), F74-F86 (2021)
   PUBMED   33283646
  REMARK    GeneRIF: Localization and regulation of claudin-14 in experimental
            models of hypercalcemia.
REFERENCE   3  (bases 1 to 1475)
  AUTHORS   Claussen M, Schulze J and Nothwang HG.
  TITLE     Loss of inner hair cell ribbon synapses and auditory nerve fiber
            regression in Cldn14 knockout mice
  JOURNAL   Hear Res 391, 107950 (2020)
   PUBMED   32251970
  REMARK    GeneRIF: Loss of inner hair cell ribbon synapses and auditory nerve
            fiber regression in Cldn14 knockout mice.
REFERENCE   4  (bases 1 to 1475)
  AUTHORS   Schluter T, Berger C, Rosengauer E, Fieth P, Krohs C, Ushakov K,
            Steel KP, Avraham KB, Hartmann AK, Felmy F and Nothwang HG.
  TITLE     miR-96 is required for normal development of the auditory hindbrain
  JOURNAL   Hum Mol Genet 27 (5), 860-874 (2018)
   PUBMED   29325119
REFERENCE   5  (bases 1 to 1475)
  AUTHORS   Ebbers L, Weber M and Nothwang HG.
  TITLE     Activity-dependent formation of a vesicular inhibitory amino acid
            transporter gradient in the superior olivary complex of NMRI mice
  JOURNAL   BMC Neurosci 18 (1), 75 (2017)
   PUBMED   29073893
  REMARK    Publication Status: Online-Only
REFERENCE   6  (bases 1 to 1475)
  AUTHORS   Elkouby-Naor L, Abassi Z, Lagziel A, Gow A and Ben-Yosef T.
  TITLE     Double gene deletion reveals lack of cooperation between claudin 11
            and claudin 14 tight junction proteins
  JOURNAL   Cell Tissue Res 333 (3), 427-438 (2008)
   PUBMED   18663477
  REMARK    GeneRIF: We generated claudin 11/claudin 14 double-deficient mice,
            which exhibit deafness, neurological deficits, and male sterility.
            Kidney function and ion balance are not significantly affected.
REFERENCE   7  (bases 1 to 1475)
  AUTHORS   Krause G, Winkler L, Mueller SL, Haseloff RF, Piontek J and Blasig
            IE.
  TITLE     Structure and function of claudins
  JOURNAL   Biochim Biophys Acta 1778 (3), 631-645 (2008)
   PUBMED   18036336
  REMARK    Review article
REFERENCE   8  (bases 1 to 1475)
  AUTHORS   Nunes FD, Lopez LN, Lin HW, Davies C, Azevedo RB, Gow A and Kachar
            B.
  TITLE     Distinct subdomain organization and molecular composition of a
            tight junction with adherens junction features
  JOURNAL   J Cell Sci 119 (Pt 23), 4819-4827 (2006)
   PUBMED   17130295
REFERENCE   9  (bases 1 to 1475)
  AUTHORS   Ben-Yosef T, Belyantseva IA, Saunders TL, Hughes ED, Kawamoto K,
            Van Itallie CM, Beyer LA, Halsey K, Gardner DJ, Wilcox ER,
            Rasmussen J, Anderson JM, Dolan DF, Forge A, Raphael Y, Camper SA
            and Friedman TB.
  TITLE     Claudin 14 knockout mice, a model for autosomal recessive deafness
            DFNB29, are deaf due to cochlear hair cell degeneration
  JOURNAL   Hum Mol Genet 12 (16), 2049-2061 (2003)
   PUBMED   12913076
  REMARK    GeneRIF: To explore the role of claudin 14 in the inner ear and in
            other tissues we created a mouse model by a targeted deletion of
            Cldn14.
REFERENCE   10 (bases 1 to 1475)
  AUTHORS   Wilcox ER, Burton QL, Naz S, Riazuddin S, Smith TN, Ploplis B,
            Belyantseva I, Ben-Yosef T, Liburd NA, Morell RJ, Kachar B, Wu DK,
            Griffith AJ, Riazuddin S and Friedman TB.
  TITLE     Mutations in the gene encoding tight junction claudin-14 cause
            autosomal recessive deafness DFNB29
  JOURNAL   Cell 104 (1), 165-172 (2001)
   PUBMED   11163249
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AC165961.2, AC168220.1,
            BE863348.1 and AI851731.1.
            
            On Oct 8, 2009 this sequence version replaced NM_019500.3.
            
            Summary: This gene encodes a member of the claudin family of tight
            junction proteins. The encoded protein is an integral membrane
            protein that may function in maintaining apical membrane
            polarization in tight junctions located between outer hair cells
            and supporting cells. Loss of function of this gene is associated
            with hearing problems. Alternative splicing results in multiple
            transcript variants. [provided by RefSeq, Oct 2009].
            
            Transcript Variant: This variant (1) represents the longest
            transcript. Variants 1, 2 and 3 encode the same protein.
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data to make the sequence consistent with the
            reference genome assembly. The genomic coordinates used for the
            transcript record were based on transcript alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AF314089.2, BC138497.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN01164131, SAMN01164132
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on conservation, expression,
                                      longest protein
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-313               AC165961.2         92817-93129
            314-451             AC168220.1         55748-55885
            452-760             BE863348.1         124-432
            761-1024            AC168220.1         78425-78688
            1025-1475           AI851731.1         1-451               c
FEATURES             Location/Qualifiers
     source          1..1475
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="16"
                     /map="16 54.99 cM"
     gene            1..1475
                     /gene="Cldn14"
                     /note="claudin 14"
                     /db_xref="GeneID:56173"
                     /db_xref="MGI:MGI:1860425"
     exon            1..313
                     /gene="Cldn14"
                     /inference="alignment:Splign:2.1.0"
     exon            314..451
                     /gene="Cldn14"
                     /inference="alignment:Splign:2.1.0"
     exon            452..1458
                     /gene="Cldn14"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    515..517
                     /gene="Cldn14"
                     /note="upstream in-frame stop codon"
     CDS             533..1252
                     /gene="Cldn14"
                     /codon_start=1
                     /product="claudin-14"
                     /protein_id="NP_062373.3"
                     /db_xref="CCDS:CCDS28345.1"
                     /db_xref="GeneID:56173"
                     /db_xref="MGI:MGI:1860425"
                     /translation="
MASTAVQLLGFLLSFLGMVGTLITTILPHWRRTAHVGTNILTAVSYLKGLWMECVWHSTGIYQCQIYRSLLALPRDLQAARALMVISCLLSGMACACAVVGMKCTRCAKGTPAKTTFAVLGGALFLLAGLLCMVAVSWTTNDVVQNFYNPLLPSGMKFEIGQALYLGFISSSLSLIGGTLLCLSCQDEAPYRPYPPQSRAGATTTATAPAYRPPAAYKDNRAPSVTSAAHSGYRLNDYV"
     misc_feature    554..616
                     /gene="Cldn14"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9Z0S3.2);
                     transmembrane region"
     misc_feature    599..1075
                     /gene="Cldn14"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:451326"
     misc_feature    776..838
                     /gene="Cldn14"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9Z0S3.2);
                     transmembrane region"
     misc_feature    878..940
                     /gene="Cldn14"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9Z0S3.2);
                     transmembrane region"
     misc_feature    1019..1081
                     /gene="Cldn14"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9Z0S3.2);
                     transmembrane region"
ORIGIN      
gtcggaatggcatgttctgaaagggcagcgttgatagctgaaactaggtgcgcctcaggccggggctgtgggaagcccgagcatcttgggcaccagcaaagtttctagcagccttgggaaggagaggaaagtcaggtggatctgattggtgggaaaggtgacctggggaaacttgccctgtggttcatacaacctgccaggcagaagcaggagccaggggcacctgagcaagaaaccccataagatgttcaagtggagttccagacaggcacctggatatagttctggacccggagggggacgcgtcaacactgggctgcatggcccagcgatctggacaaaggccaagaagccaaagactgttgaagccgcagtctccactcttctactgacgccagcgaccacccagcccagccaggccatatggcctcctgcttgcctgatgtatgaggcttcctgcgggcacctaaggaccagatccatccctggggacctgggcactgctcagcgcggctagcaggggcccttagccatggccagcacagcggtccagctcctaggcttcctgcttagcttcctgggcatggtaggaacgctcatcaccaccatcctgccacactggcggaggacggcccatgtgggcaccaacatcctgactgccgtatcctacctgaagggactgtggatggaatgtgtgtggcacagcacaggcatctaccagtgtcagatctaccgctcactgctggcgctgccccgggacttgcaggccgcccgggcgctcatggtcatctcctgcctgttgtcgggcatggcctgcgcctgcgcagtagtgggcatgaagtgcacacgctgcgccaaaggcacacccgccaagaccacctttgcagtgctggggggcgcgctcttcctgctggccggcctgctgtgcatggtggccgtgtcctggaccacgaatgacgtggtgcagaatttttataacccgctgctgcccagtggcatgaagtttgaaatcggccaggccctgtacctgggcttcatctcctcatccctgtctctcatcgggggcaccctgctctgcttatcctgccaggacgaggccccctacagaccctacccgccccagtccagggccggagctaccaccacggctaccgcccctgcctaccgcccaccagcggcctacaaggacaaccgtgccccctcggtgacctcagccgcgcacagtgggtacaggctgaatgactacgtgtgagttccttccccgggcttctgccagggatgctgggccccaaaggaccaatgatggatgtgggaaggatgcagagagcaagcccggaacacagggaaggaggtgctcttcaaagcaaagacttctaaaaagtgctggttttttatttattatatgtatttatgcgggtggcttaataagagctcaataaagagtgtcttggaagcgtgaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]