GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2020-04-06 12:21:29, GGRNA.v2 : RefSeq release 99 (Mar, 2020)

LOCUS       NM_010420               1144 bp    mRNA    linear   ROD 20-OCT-2019
DEFINITION  Mus musculus homeobox gene expressed in ES cells (Hesx1), mRNA.
ACCESSION   NM_010420
VERSION     NM_010420.2
KEYWORDS    RefSeq.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 1144)
  AUTHORS   Lodge EJ, Santambrogio A, Russell JP, Xekouki P, Jacques TS,
            Johnson RL, Thavaraj S, Bornstein SR and Andoniadou CL.
  TITLE     Homeostatic and tumourigenic activity of SOX2+ pituitary stem cells
            is controlled by the LATS/YAP/TAZ cascade
  JOURNAL   Elife 8, e43996 (2019)
   PUBMED   30912742
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1144)
  AUTHORS   Gonzalez-Meljem JM, Haston S, Carreno G, Apps JR, Pozzi S, Stache
            C, Kaushal G, Virasami A, Panousopoulos L, Mousavy-Gharavy SN,
            Guerrero A, Rashid M, Jani N, Goding CR, Jacques TS, Adams DJ, Gil
            J, Andoniadou CL and Martinez-Barbera JP.
  TITLE     Stem cell senescence drives age-attenuated induction of pituitary
            tumours in mouse models of paediatric craniopharyngioma
  JOURNAL   Nat Commun 8 (1), 1819 (2017)
   PUBMED   29180744
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1144)
  AUTHORS   Huang X, Balmer S, Yang F, Fidalgo M, Li D, Guallar D,
            Hadjantonakis AK and Wang J.
  TITLE     Zfp281 is essential for mouse epiblast maturation through
            transcriptional and epigenetic control of Nodal signaling
  JOURNAL   Elife 6, e33333 (2017)
   PUBMED   29168693
  REMARK    Publication Status: Online-Only
REFERENCE   4  (bases 1 to 1144)
  AUTHORS   Carreno G, Apps JR, Lodge EJ, Panousopoulos L, Haston S,
            Gonzalez-Meljem JM, Hahn H, Andoniadou CL and Martinez-Barbera JP.
  TITLE     Hypothalamic sonic hedgehog is required for cell specification and
            proliferation of LHX3/LHX4 pituitary embryonic precursors
  JOURNAL   Development 144 (18), 3289-3302 (2017)
   PUBMED   28807898
REFERENCE   5  (bases 1 to 1144)
  AUTHORS   Haston S, Pozzi S, Carreno G, Manshaei S, Panousopoulos L,
            Gonzalez-Meljem JM, Apps JR, Virasami A, Thavaraj S, Gutteridge A,
            Forshew T, Marais R, Brandner S, Jacques TS, Andoniadou CL and
            Martinez-Barbera JP.
  TITLE     MAPK pathway control of stem cell proliferation and differentiation
            in the embryonic pituitary provides insights into the pathogenesis
            of papillary craniopharyngioma
  JOURNAL   Development 144 (12), 2141-2152 (2017)
   PUBMED   28506993
REFERENCE   6  (bases 1 to 1144)
  AUTHORS   Sheng HZ, Zhadanov AB, Mosinger B Jr, Fujii T, Bertuzzi S, Grinberg
            A, Lee EJ, Huang SP, Mahon KA and Westphal H.
  TITLE     Specification of pituitary cell lineages by the LIM homeobox gene
            Lhx3
  JOURNAL   Science 272 (5264), 1004-1007 (1996)
   PUBMED   8638120
REFERENCE   7  (bases 1 to 1144)
  AUTHORS   Hermesz E, Mackem S and Mahon KA.
  TITLE     Rpx: a novel anterior-restricted homeobox gene progressively
            activated in the prechordal plate, anterior neural plate and
            Rathke's pouch of the mouse embryo
  JOURNAL   Development 122 (1), 41-52 (1996)
   PUBMED   8565852
REFERENCE   8  (bases 1 to 1144)
  AUTHORS   Thomas PQ, Johnson BV, Rathjen J and Rathjen PD.
  TITLE     Sequence, genomic organization, and expression of the novel
            homeobox gene Hesx1
  JOURNAL   J. Biol. Chem. 270 (8), 3869-3875 (1995)
   PUBMED   7876132
REFERENCE   9  (bases 1 to 1144)
  AUTHORS   Webb GC, Thomas PQ, Ford JH and Rathjen PD.
  TITLE     Hesx1, a homeobox gene expressed by murine embryonic stem cells,
            maps to mouse chromosome 14, bands A3-B
  JOURNAL   Genomics 18 (2), 464-466 (1993)
   PUBMED   7904583
REFERENCE   10 (bases 1 to 1144)
  AUTHORS   Thomas PQ and Rathjen PD.
  TITLE     HES-1, a novel homeobox gene expressed by murine embryonic stem
            cells, identifies a new class of homeobox genes
  JOURNAL   Nucleic Acids Res. 20 (21), 5840 (1992)
   PUBMED   1360650
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AC124603.5, BC132051.1 and U40720.1.
            On Mar 21, 2009 this sequence version replaced NM_010420.1.
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data to make the sequence consistent with the
            reference genome assembly. The genomic coordinates used for the
            transcript record were based on transcript alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: U40720.1, X80040.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN01164133, SAMN01164134
                                           [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-515               AC124603.5         115103-115617
            516-817             BC132051.1         342-643
            818-1144            U40720.1           816-1142
FEATURES             Location/Qualifiers
     source          1..1144
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="14"
                     /map="14"
     gene            1..1144
                     /gene="Hesx1"
                     /gene_synonym="HES-1; Rpx"
                     /note="homeobox gene expressed in ES cells"
                     /db_xref="GeneID:15209"
                     /db_xref="MGI:MGI:96071"
     exon            1..515
                     /gene="Hesx1"
                     /gene_synonym="HES-1; Rpx"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    287..289
                     /gene="Hesx1"
                     /gene_synonym="HES-1; Rpx"
                     /note="upstream in-frame stop codon"
     CDS             359..916
                     /gene="Hesx1"
                     /gene_synonym="HES-1; Rpx"
                     /note="homeobox protein ANF; rathke pouch homeo box;
                     anterior-restricted homeobox protein; homeo box gene
                     expressed in ES cells"
                     /codon_start=1
                     /product="homeobox expressed in ES cells 1"
                     /protein_id="NP_034550.2"
                     /db_xref="CCDS:CCDS26884.1"
                     /db_xref="GeneID:15209"
                     /db_xref="MGI:MGI:96071"
                     /translation="
MSPSLREGAQLRESKPAPCSFSIESILGLDQKKDCTTSVRPHRPWTDTCGDSEKGGNPPLHAPDLPSETSFPCPVDHPRPEERAPKYENYFSASETRSLKRELSWYRGRRPRTAFTQNQVEVLENVFRVNCYPGIDIREDLAQKLNLEEDRIQIWFQNRRAKMKRSRRESQFLMAKKPFNPDLLK"
     misc_feature    order(683..697,701..703,752..754,770..772,809..811,
                     815..820,827..832,836..844,848..853)
                     /gene="Hesx1"
                     /gene_synonym="HES-1; Rpx"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    689..850
                     /gene="Hesx1"
                     /gene_synonym="HES-1; Rpx"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:278475"
     misc_feature    order(689..691,698..700,818..820,827..832,839..841)
                     /gene="Hesx1"
                     /gene_synonym="HES-1; Rpx"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     exon            516..715
                     /gene="Hesx1"
                     /gene_synonym="HES-1; Rpx"
                     /inference="alignment:Splign:2.1.0"
     exon            716..817
                     /gene="Hesx1"
                     /gene_synonym="HES-1; Rpx"
                     /inference="alignment:Splign:2.1.0"
     exon            818..1138
                     /gene="Hesx1"
                     /gene_synonym="HES-1; Rpx"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
gattttatacattaatgatctcaaataaaagaggagtgctatgttcgtgcaccacttcttctgagaaagttaagtctgcgttctgcttaggagagataacactttttgtccctgtaggtggccccctggtgtagccattagttgctaattacttgcaaacaaataaacaattaactccttaagccgctggctgggcaagtgttcattgacttgctaaaactttctaaaacaggattttaattagtgactttggaaacccagccccctagtcagcaaagctacaaggtgaactgctggaagatcccagctctgcacacgtggggcaggagccctccggcgctgtacgacccagaagagaatgtctcccagccttcgggaaggtgctcagctccgggaaagcaagcccgcgccctgctccttctcaattgagagcattttaggactggaccagaaaaaagattgtacaacgtcagtaagaccccacagaccctggacagacacctgcggtgactcagagaaaggtggcaacccacccctacatgccccagatcttcccagtgagacttcatttccttgtccagtggatcatccaaggccagaagaaagggctccgaaatatgaaaattatttttcagcctccgaaacacgctctttgaaaagagaattgagttggtaccgaggacgaaggccaagaaccgctttcacccagaaccaggtcgaagtattggaaaatgtctttagagtgaactgctaccctggcattgacatcagagaggacctagctcaaaagctgaacttagaggaagacagaatccagatttggttccaaaatcgccgagcaaagatgaaaaggtcccgtagagaatcacagtttctaatggcgaaaaaacccttcaacccagatcttctgaaataggtagaaaattacacatgttggcttctcttccagttgtatagtacagaagaaatcaatggaaattccaagtacttaaaatgttacagttctctcctgtatctaatctagattttgtcattctttctgaaaatactgcaaataattatggttctagaacagtacatttttagttataattaaaacatctttcctatatatttttaataaaaaaattttcagaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]