GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2019-03-25 14:32:20, GGRNA.v2 : RefSeq release 92 (Jan, 2019)

LOCUS       NM_006562               1287 bp    mRNA    linear   PRI 23-JUN-2018
DEFINITION  Homo sapiens ladybird homeobox 1 (LBX1), mRNA.
ACCESSION   NM_006562
VERSION     NM_006562.4
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1287)
  AUTHORS   Liu S, Wu N, Zuo Y, Zhou Y, Liu J, Liu Z, Chen W, Liu G, Chen Y,
            Chen J, Lin M, Zhao Y, Ming Y, Yuan T, Li X, Xia Z, Yang X, Ma Y,
            Zhang J, Shen J, Li S, Wang Y, Zhao H, Yu K, Zhao Y, Weng X, Qiu G
            and Wu Z.
  TITLE     Genetic Polymorphism of LBX1 Is Associated With Adolescent
            Idiopathic Scoliosis in Northern Chinese Han Population
  JOURNAL   Spine 42 (15), 1125-1129 (2017)
   PUBMED   28187071
  REMARK    GeneRIF: Two single nucleotide polymorphisms around LBX1 are
            associated with adolescent idiopathic scoliosis in a Northern
            Chinese Han population.
REFERENCE   2  (bases 1 to 1287)
  AUTHORS   Cao Y, Min J, Zhang Q, Li H and Li H.
  TITLE     Associations of LBX1 gene and adolescent idiopathic scoliosis
            susceptibility: a meta-analysis based on 34,626 subjects
  JOURNAL   BMC Musculoskelet Disord 17, 309 (2016)
   PUBMED   27450593
  REMARK    GeneRIF: Meta-analysis provides evidence that rs111090870, rs678741
            and rs625039 polymorphisms near LBX1 gene are associated with
            adolescent idiopathic scoliosis susceptibility in some
            populations.[meta-analysis]
            Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1287)
  AUTHORS   Guo L, Yamashita H, Kou I, Takimoto A, Meguro-Horike M, Horike S,
            Sakuma T, Miura S, Adachi T, Yamamoto T, Ikegawa S, Hiraki Y and
            Shukunami C.
  TITLE     Functional Investigation of a Non-coding Variant Associated with
            Adolescent Idiopathic Scoliosis in Zebrafish: Elevated Expression
            of the Ladybird Homeobox Gene Causes Body Axis Deformation
  JOURNAL   PLoS Genet. 12 (1), e1005802 (2016)
   PUBMED   26820155
  REMARK    GeneRIF: In embryos overexpressing lbx1b, wnt5b, a ligand of the
            non-canonical Wnt/planar cell polarity (PCP) pathway, was
            significantly downregulated.
            Publication Status: Online-Only
REFERENCE   4  (bases 1 to 1287)
  AUTHORS   Grauers A, Wang J, Einarsdottir E, Simony A, Danielsson A, Akesson
            K, Ohlin A, Halldin K, Grabowski P, Tenne M, Laivuori H, Dahlman I,
            Andersen M, Christensen SB, Karlsson MK, Jiao H, Kere J and Gerdhem
            P.
  TITLE     Candidate gene analysis and exome sequencing confirm LBX1 as a
            susceptibility gene for idiopathic scoliosis
  JOURNAL   Spine J 15 (10), 2239-2246 (2015)
   PUBMED   25987191
  REMARK    GeneRIF: LBX1 is a susceptibility gene for idiopathic scoliosis in
            a Scandinavian population.
REFERENCE   5  (bases 1 to 1287)
  AUTHORS   Chettier R, Nelson L, Ogilvie JW, Albertsen HM and Ward K.
  TITLE     Haplotypes at LBX1 have distinct inheritance patterns with opposite
            effects in adolescent idiopathic scoliosis
  JOURNAL   PLoS ONE 10 (2), e0117708 (2015)
   PUBMED   25675428
  REMARK    GeneRIF: Our results identify two clinically relevant haplotypes in
            the LBX1-region with opposite effects on AIS risk.
            Publication Status: Online-Only
REFERENCE   6  (bases 1 to 1287)
  AUTHORS   Deloukas P, Earthrowl ME, Grafham DV, Rubenfield M, French L,
            Steward CA, Sims SK, Jones MC, Searle S, Scott C, Howe K, Hunt SE,
            Andrews TD, Gilbert JG, Swarbreck D, Ashurst JL, Taylor A, Battles
            J, Bird CP, Ainscough R, Almeida JP, Ashwell RI, Ambrose KD,
            Babbage AK, Bagguley CL, Bailey J, Banerjee R, Bates K, Beasley H,
            Bray-Allen S, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J,
            Cahill P, Camire D, Carter NP, Chapman JC, Clark SY, Clarke G, Clee
            CM, Clegg S, Corby N, Coulson A, Dhami P, Dutta I, Dunn M, Faulkner
            L, Frankish A, Frankland JA, Garner P, Garnett J, Gribble S,
            Griffiths C, Grocock R, Gustafson E, Hammond S, Harley JL, Hart E,
            Heath PD, Ho TP, Hopkins B, Horne J, Howden PJ, Huckle E, Hynds C,
            Johnson C, Johnson D, Kana A, Kay M, Kimberley AM, Kershaw JK,
            Kokkinaki M, Laird GK, Lawlor S, Lee HM, Leongamornlert DA, Laird
            G, Lloyd C, Lloyd DM, Loveland J, Lovell J, McLaren S, McLay KE,
            McMurray A, Mashreghi-Mohammadi M, Matthews L, Milne S, Nickerson
            T, Nguyen M, Overton-Larty E, Palmer SA, Pearce AV, Peck AI, Pelan
            S, Phillimore B, Porter K, Rice CM, Rogosin A, Ross MT, Sarafidou
            T, Sehra HK, Shownkeen R, Skuce CD, Smith M, Standring L, Sycamore
            N, Tester J, Thorpe A, Torcasso W, Tracey A, Tromans A, Tsolas J,
            Wall M, Walsh J, Wang H, Weinstock K, West AP, Willey DL, Whitehead
            SL, Wilming L, Wray PW, Young L, Chen Y, Lovering RC, Moschonas NK,
            Siebert R, Fechtel K, Bentley D, Durbin R, Hubbard T,
            Doucette-Stamm L, Beck S, Smith DR and Rogers J.
  TITLE     The DNA sequence and comparative analysis of human chromosome 10
  JOURNAL   Nature 429 (6990), 375-381 (2004)
   PUBMED   15164054
REFERENCE   7  (bases 1 to 1287)
  AUTHORS   de Mollerat XJ, Gurrieri F, Morgan CT, Sangiorgi E, Everman DB,
            Gaspari P, Amiel J, Bamshad MJ, Lyle R, Blouin JL, Allanson JE, Le
            Marec B, Wilson M, Braverman NE, Radhakrishna U, Delozier-Blanchet
            C, Abbott A, Elghouzzi V, Antonarakis S, Stevenson RE, Munnich A,
            Neri G and Schwartz CE.
  TITLE     A genomic rearrangement resulting in a tandem duplication is
            associated with split hand-split foot malformation 3 (SHFM3) at
            10q24
  JOURNAL   Hum. Mol. Genet. 12 (16), 1959-1971 (2003)
   PUBMED   12913067
REFERENCE   8  (bases 1 to 1287)
  AUTHORS   Kozmik Z, Holland LZ, Schubert M, Lacalli TC, Kreslova J, Vlcek C
            and Holland ND.
  TITLE     Characterization of Amphioxus AmphiVent, an evolutionarily
            conserved marker for chordate ventral mesoderm
  JOURNAL   Genesis 29 (4), 172-179 (2001)
   PUBMED   11309850
REFERENCE   9  (bases 1 to 1287)
  AUTHORS   Jagla K, Dolle P, Mattei MG, Jagla T, Schuhbaur B, Dretzen G,
            Bellard F and Bellard M.
  TITLE     Mouse Lbx1 and human LBX1 define a novel mammalian homeobox gene
            family related to the Drosophila lady bird genes
  JOURNAL   Mech. Dev. 53 (3), 345-356 (1995)
   PUBMED   8645601
REFERENCE   10 (bases 1 to 1287)
  AUTHORS   Moretti P, Simmons P, Thomas P, Haylock D, Rathjen P, Vadas M and
            D'Andrea R.
  TITLE     Identification of homeobox genes expressed in human haemopoietic
            progenitor cells
  JOURNAL   Gene 144 (2), 213-219 (1994)
   PUBMED   7518789
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AL135794.19 and BC069156.1.
            This sequence is a reference standard in the RefSeqGene project.
            On May 5, 2005 this sequence version replaced NM_006562.3.
            
            Summary: This gene and the orthologous mouse gene were found by
            their homology to the Drosophila lady bird early and late homeobox
            genes. In the mouse, this gene is a key regulator of muscle
            precursor cell migration and is required for the acquisition of
            dorsal identities of forelimb muscles. [provided by RefSeq, Jul
            2008].
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC069156.1, BC136321.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA2148874, SAMEA2154361
                                           [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: full length.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-409               AL135794.19        83191-83599         c
            410-1287            BC069156.1         411-1288
FEATURES             Location/Qualifiers
     source          1..1287
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="10"
                     /map="10q24.32"
     gene            1..1287
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /note="ladybird homeobox 1"
                     /db_xref="GeneID:10660"
                     /db_xref="HGNC:HGNC:16960"
                     /db_xref="MIM:604255"
     exon            1..470
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /inference="alignment:Splign:2.1.0"
     variation       complement(4)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1041386686"
     variation       complement(6)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1440138549"
     variation       complement(9)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1175237419"
     variation       complement(11)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:943968834"
     variation       complement(12)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1303445079"
     variation       complement(13..23)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace=""
                     /replace="ggcccgcgccc"
                     /db_xref="dbSNP:1444786500"
     variation       complement(14)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:908240860"
     STS             29..1176
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /db_xref="UniSTS:491162"
     variation       complement(33)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1333674434"
     variation       complement(35)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:982478843"
     variation       complement(36)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1219075571"
     variation       complement(44)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:952316567"
     variation       complement(46)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1176353107"
     variation       complement(47)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:919691544"
     variation       complement(49)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1397808389"
     variation       complement(57)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:991206892"
     variation       complement(61)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1460518476"
     variation       complement(63)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1456951186"
     variation       complement(65..80)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace=""
                     /replace="ggcggcggccg"
                     /db_xref="dbSNP:1480835440"
     variation       complement(65)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1196344813"
     variation       complement(66)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1397134036"
     variation       complement(72)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:541785921"
     variation       complement(80)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1239666846"
     variation       complement(83)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1174424454"
     variation       complement(89)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1454574101"
     variation       complement(90)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1265020750"
     variation       complement(97)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:749032901"
     variation       complement(98)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1434769073"
     variation       complement(101)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1177106597"
     variation       complement(102)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1335273046"
     variation       complement(105)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:756384050"
     variation       complement(106)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1422982150"
     variation       complement(107)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1326706739"
     variation       complement(108)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:746254775"
     variation       complement(110)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1173087784"
     variation       complement(111)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:781495254"
     variation       complement(113)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:751671979"
     variation       complement(115)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1033834154"
     variation       complement(117)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1278588701"
     variation       complement(121)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:764313562"
     variation       complement(123)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:758585728"
     variation       complement(124..125)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace=""
                     /replace="ccggccggtccccggcc"
                     /db_xref="dbSNP:748378062"
     variation       complement(125)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1370215897"
     variation       complement(127)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:752530442"
     STS             128..1038
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /db_xref="UniSTS:482114"
     variation       complement(132)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:765236602"
     variation       complement(143)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:759188951"
     CDS             146..991
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /note="lady bird-like homeobox; transcription factor
                     similar to D. melanogaster homeodomain protein lady bird
                     late; ladybird homeobox protein homolog 1; ladybird
                     homeobox homolog 1"
                     /codon_start=1
                     /product="transcription factor LBX1"
                     /protein_id="NP_006553.2"
                     /db_xref="CCDS:CCDS31270.1"
                     /db_xref="GeneID:10660"
                     /db_xref="HGNC:HGNC:16960"
                     /db_xref="MIM:604255"
                     /translation="
MTSKEDGKAAPGEERRRSPLDHLPPPANSNKPLTPFSIEDILNKPSVRRSYSLCGAAHLLAAADKHAQGGLPLAGRALLSQTSPLCALEELASKTFKGLEVSVLQAAEGRDGMTIFGQRQTPKKRRKSRTAFTNHQIYELEKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKLKRDLEEMKADVESAKKLGPSGQMDIVALAELEQNSEATAGGGGGCGRAKSRPGSPVLPPGAPKAPGAGALQLSPASPLTDQPASSQDCSEDEEDEEIDVDD"
     misc_feature    order(521..535,539..541,590..592,608..610,647..649,
                     653..658,665..670,674..682,686..691)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    527..688
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:278475"
     misc_feature    order(527..529,536..538,656..658,665..670,677..679)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     variation       complement(153)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1459185807"
     variation       complement(154)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:776557348"
     variation       complement(156)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:766003298"
     variation       complement(160)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:574381608"
     variation       complement(161)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:760369442"
     variation       complement(163)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:772676696"
     variation       complement(164)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:771528976"
     variation       complement(165)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:139870892"
     variation       complement(167)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:775799886"
     variation       complement(171)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:770335924"
     variation       complement(174)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:746210714"
     variation       complement(175)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:781726145"
     variation       complement(178)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1474988314"
     variation       complement(180)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1255870380"
     variation       complement(181)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:757525480"
     variation       complement(182)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1443500331"
     variation       complement(187)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201625035"
     variation       complement(188)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1489353886"
     variation       complement(189)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:758355487"
     variation       complement(191)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:752829144"
     variation       complement(194)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1259399105"
     variation       complement(195)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1218919499"
     variation       complement(199)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:765083052"
     variation       complement(201)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:755002388"
     variation       complement(202)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:753609321"
     variation       complement(210)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1401329960"
     variation       complement(212)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1328175825"
     variation       complement(215)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1389572877"
     variation       complement(216)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:766202085"
     variation       complement(217)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1332062928"
     variation       complement(218)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201740254"
     variation       complement(220)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:144681046"
     variation       complement(229)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1021587363"
     variation       complement(230)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1448856637"
     variation       complement(232)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1473365447"
     variation       complement(235)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:78030099"
     variation       complement(239)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1180344255"
     variation       complement(253)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:767169264"
     variation       complement(259)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:761159519"
     variation       complement(260)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:773975495"
     variation       complement(262)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1467758664"
     variation       complement(266)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1270944177"
     variation       complement(269)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1211258858"
     variation       complement(273)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1356834055"
     variation       complement(274)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:770184475"
     variation       complement(276)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:760134879"
     variation       complement(278)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1337417136"
     variation       complement(279)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:149366935"
     variation       complement(280)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:777314146"
     variation       complement(283)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:771377105"
     variation       complement(284)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:976174629"
     variation       complement(286)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199856457"
     variation       complement(289)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1279469207"
     variation       complement(291)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1362082730"
     variation       complement(292)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:964672390"
     variation       complement(294)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1384766655"
     variation       complement(296)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:778075900"
     variation       complement(298)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1471460383"
     variation       complement(300)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:772406585"
     variation       complement(302)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1193540961"
     variation       complement(305)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:78808889"
     variation       complement(306)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1453337590"
     variation       complement(308)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:748164654"
     variation       complement(310)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1227337140"
     variation       complement(311..312)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:1287347929"
     variation       complement(311)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:779099123"
     variation       complement(312)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:775436724"
     variation       complement(313)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1451769597"
     variation       complement(314)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1283331863"
     variation       complement(316)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:372911687"
     variation       complement(318)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1180197500"
     variation       complement(321)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1223020457"
     variation       complement(322)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:765415448"
     variation       complement(326)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1286726836"
     variation       complement(327)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1233470514"
     variation       complement(328)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1368924389"
     variation       complement(329)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1276666567"
     variation       complement(330)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1437490336"
     variation       complement(334)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1326038242"
     variation       complement(337)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:201116367"
     variation       complement(339)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1218741375"
     variation       complement(340)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:755844405"
     variation       complement(341)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:750221025"
     variation       complement(342)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1472535462"
     variation       complement(343)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1173602358"
     variation       complement(344)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1433372909"
     variation       complement(345)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1392744033"
     variation       complement(346)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:767070677"
     variation       complement(353)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:761580258"
     variation       complement(354)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1241098274"
     variation       complement(355)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1190557621"
     variation       complement(356)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1489188241"
     variation       complement(359)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:751007989"
     variation       complement(360)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1210139359"
     variation       complement(361)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1345584064"
     variation       complement(365)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374088465"
     variation       complement(366)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:762578273"
     variation       complement(367)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1006789896"
     variation       complement(368)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370705329"
     variation       complement(369)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:771573097"
     variation       complement(371)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:367613299"
     variation       complement(372)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:887032168"
     variation       373
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:941909"
     variation       complement(374)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:772162855"
     variation       complement(376)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:930978329"
     variation       complement(378)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1177618912"
     variation       complement(380)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:748443716"
     variation       complement(382)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:779033539"
     variation       complement(384)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1418164651"
     variation       complement(385)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:768732597"
     variation       complement(388)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1248338996"
     variation       complement(389)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:919577485"
     variation       complement(393)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1424100964"
     variation       complement(394)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1186913128"
     variation       complement(397)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1484655324"
     variation       complement(400)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:749381215"
     variation       complement(401)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1210712822"
     variation       complement(403)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1437355105"
     variation       complement(404)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1270940427"
     variation       complement(406)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1220716119"
     variation       complement(407)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1318818417"
     variation       complement(409)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:779898134"
     variation       complement(410)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1231780527"
     variation       complement(411)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1284922642"
     variation       complement(413)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:991260880"
     variation       complement(415)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1303998823"
     variation       complement(418)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:181600364"
     variation       complement(419)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:554998242"
     variation       complement(424)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1353467362"
     variation       complement(430)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1328629688"
     variation       complement(435)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1466891699"
     variation       complement(437)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1423816982"
     variation       complement(438)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1239302375"
     variation       complement(439)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:781315859"
     variation       complement(442)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:937070635"
     variation       complement(443)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:750202790"
     variation       complement(446)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1474138369"
     variation       complement(452)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1415651462"
     variation       complement(457)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:894800042"
     variation       complement(459)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1378802505"
     variation       complement(463)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1055225594"
     variation       complement(465)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1399756423"
     variation       complement(467)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:781085498"
     exon            471..1285
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /inference="alignment:Splign:2.1.0"
     variation       complement(475)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1452863368"
     variation       complement(476)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1290882169"
     variation       complement(478)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:757024359"
     variation       complement(479)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:889329802"
     variation       complement(482)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1423471448"
     variation       complement(488)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:746787274"
     variation       complement(492)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1243699054"
     variation       complement(500)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:777481294"
     variation       complement(501)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:200100962"
     variation       complement(506)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:752235246"
     variation       complement(508)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:930773396"
     variation       complement(511)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:764879774"
     variation       complement(520)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1359322340"
     variation       complement(523)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:754567553"
     variation       complement(538)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:750892945"
     variation       complement(549)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:569188647"
     variation       complement(553)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:762168496"
     variation       complement(563)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:377566797"
     variation       complement(568)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1045803823"
     variation       complement(571)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:764284419"
     variation       complement(583)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:138821635"
     variation       complement(589)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1362151611"
     variation       complement(591)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1230358298"
     variation       complement(594)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1270544543"
     variation       complement(595)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1313424992"
     variation       complement(596)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:763209093"
     variation       complement(599)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1381271558"
     variation       complement(604)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1036343277"
     variation       complement(605)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1312582850"
     variation       complement(607)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1429834495"
     variation       complement(610)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:781557515"
     variation       complement(614)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1445336559"
     variation       complement(619)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:775512624"
     variation       complement(621)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200544289"
     variation       complement(622)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1400572543"
     variation       complement(627)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1217966141"
     variation       complement(631)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:745951412"
     variation       complement(643)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:532179935"
     variation       complement(645)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:564963650"
     variation       complement(646)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:746808888"
     variation       complement(652)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1378276897"
     variation       complement(657)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:374673460"
     variation       complement(658)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1483023997"
     variation       complement(659..680)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace=""
                     /replace="tggttccagaatcggcgcgcta"
                     /db_xref="dbSNP:1476953432"
     variation       complement(672)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1182004667"
     variation       complement(685)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:758093491"
     variation       complement(691)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1194748506"
     variation       complement(694)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1485636644"
     variation       complement(700)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1424694166"
     variation       complement(704)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:747764111"
     variation       complement(710)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:12776987"
     variation       complement(712)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:778729760"
     variation       complement(715)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:754479753"
     variation       complement(718)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:12778447"
     variation       complement(719)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1364425345"
     variation       complement(725)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:753290654"
     variation       complement(730)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1226269144"
     variation       complement(733)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150343401"
     variation       complement(739)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1158574226"
     variation       complement(745)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:757759050"
     variation       complement(748)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1406497750"
     variation       complement(754)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:751928265"
     variation       complement(755)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:12776825"
     variation       complement(758)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:764478442"
     variation       complement(763)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:763334617"
     variation       complement(764)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1397684239"
     variation       complement(765)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:141719108"
     variation       complement(766)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1297639311"
     variation       complement(767)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:765454424"
     variation       complement(769)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:759659325"
     variation       complement(770)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:201747133"
     variation       complement(771)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:12777140"
     variation       complement(772)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:771945234"
     variation       complement(775)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1054110961"
     variation       complement(778)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1424854774"
     variation       complement(781)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1423288304"
     variation       complement(787)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1256285597"
     variation       complement(789)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:12777128"
     variation       complement(790)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:917807575"
     variation       complement(791)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:12776802"
     variation       complement(794)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199635468"
     variation       complement(795)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:778641851"
     variation       complement(796)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1348365868"
     variation       complement(801)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1198883424"
     variation       complement(802)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:959457907"
     variation       complement(803)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:768258734"
     variation       complement(805)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1282191719"
     variation       complement(806)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1246933443"
     variation       complement(808)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1340918634"
     variation       complement(812)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370090440"
     variation       complement(813..814)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace=""
                     /replace="tggcgg"
                     /db_xref="dbSNP:779320459"
     variation       complement(816)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:757749183"
     variation       complement(820)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1379200375"
     variation       complement(821)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1332345860"
     variation       complement(824)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:751966314"
     variation       complement(825)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1389051382"
     variation       complement(826)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1165324032"
     variation       complement(827)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:778272282"
     variation       complement(831)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:758699530"
     variation       complement(834)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:561287757"
     variation       complement(840)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1437355706"
     variation       complement(846)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:925440581"
     variation       complement(847)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:543223691"
     variation       complement(848)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1178332623"
     variation       complement(849)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:759728893"
     variation       complement(850)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1287471636"
     variation       complement(853)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:753925634"
     variation       complement(854)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1356766880"
     variation       complement(856)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1408032429"
     variation       complement(857)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:766331423"
     variation       complement(858)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:199819784"
     variation       complement(859)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:200155323"
     variation       complement(860)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:772137654"
     variation       complement(861)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:912598304"
     variation       complement(862)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:987213956"
     variation       complement(863)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:761695761"
     variation       complement(866)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:774344628"
     variation       complement(867)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:768329748"
     variation       complement(869)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:368271119"
     variation       complement(870)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1384695933"
     variation       complement(871)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:779784691"
     variation       complement(874)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1019153303"
     variation       complement(875)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:769133813"
     variation       complement(876)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:745389734"
     variation       complement(879)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1477497171"
     variation       complement(880)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:778251802"
     variation       complement(881)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1200540649"
     variation       complement(883)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1452005189"
     variation       complement(884)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:758965574"
     variation       complement(889)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:748493519"
     variation       complement(890)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1355715794"
     variation       complement(892)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1286832952"
     variation       complement(894)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:779290896"
     variation       complement(903)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1342948763"
     variation       complement(904)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:755401297"
     variation       complement(905)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1276899630"
     variation       complement(907)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1198288421"
     variation       complement(908)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:962561467"
     variation       complement(909)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1234202199"
     variation       complement(910)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:753959715"
     variation       complement(912)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:889271580"
     variation       complement(914)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:377118339"
     variation       complement(915)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:756080073"
     variation       complement(916)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1361664866"
     variation       complement(917)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1312787281"
     variation       complement(919)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1205828320"
     variation       complement(921)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:144870790"
     variation       complement(922)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:767548212"
     variation       complement(927)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1049253627"
     variation       complement(929)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1174015740"
     variation       complement(930)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:774252655"
     variation       complement(932)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1430824652"
     variation       complement(936)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:971731139"
     variation       complement(939)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:763753178"
     variation       complement(940)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:762826884"
     variation       complement(944)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:774944786"
     variation       complement(949)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:556049854"
     variation       complement(950)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1440811410"
     variation       complement(951)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371863719"
     variation       complement(952)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1201271279"
     variation       complement(954)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:769560237"
     variation       complement(958)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1276707295"
     variation       complement(961..963)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace=""
                     /replace="gga"
                     /db_xref="dbSNP:755087702"
     variation       complement(965)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141161147"
     variation       complement(967)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1284163300"
     variation       complement(968)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1446427670"
     variation       complement(969)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1356951609"
     variation       complement(973)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:776172521"
     variation       complement(979)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1414686033"
     variation       complement(980)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:772539789"
     variation       complement(982)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1168078923"
     variation       complement(985)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:577653354"
     variation       complement(988)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1424035521"
     variation       complement(993)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:150918757"
     variation       complement(995)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:755242503"
     variation       complement(997)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:749666785"
     variation       complement(998)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:547938282"
     variation       complement(1000)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:780133460"
     variation       complement(1001)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:756462879"
     variation       complement(1009)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1200723498"
     variation       complement(1010)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:750507875"
     variation       complement(1011)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:757439246"
     variation       complement(1018)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1227135251"
     variation       complement(1020)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1010337485"
     variation       complement(1022)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1225392738"
     variation       complement(1024)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:751491376"
     variation       complement(1026)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:764102635"
     variation       complement(1028)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:891435466"
     variation       complement(1030)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:762655192"
     variation       complement(1032..1033)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:753920962"
     variation       complement(1032)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:775416742"
     variation       complement(1033)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1210171671"
     variation       complement(1037)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:764779848"
     variation       complement(1038)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1056769726"
     variation       complement(1044)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1422615942"
     variation       complement(1045)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:937965677"
     variation       complement(1051)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:926550170"
     variation       complement(1054)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1040266597"
     variation       complement(1057)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:111303170"
     variation       complement(1060)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1228463742"
     variation       complement(1061)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1314735755"
     variation       complement(1063)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1357800233"
     variation       complement(1064)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:967861736"
     variation       complement(1067)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1160260807"
     variation       complement(1077)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:765343334"
     variation       complement(1085)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1293231423"
     variation       complement(1089)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:534762409"
     variation       complement(1090)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1356425825"
     variation       complement(1092)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1457212611"
     variation       complement(1095)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1051328894"
     variation       complement(1096)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1193485590"
     variation       complement(1096)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:987888953"
     variation       complement(1097)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1242279815"
     variation       complement(1115)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:965676357"
     variation       complement(1117)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1018641878"
     variation       complement(1118)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1008208013"
     variation       complement(1120)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1475541207"
     variation       complement(1121)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1452968194"
     variation       complement(1122)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:1255738596"
     variation       complement(1125)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1387260977"
     variation       complement(1126)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:953632278"
     variation       complement(1135)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1482168421"
     variation       complement(1136)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1243685571"
     variation       complement(1139)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1216206422"
     variation       complement(1141)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:974193892"
     variation       complement(1148)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1328482688"
     variation       complement(1154)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1266155795"
     variation       complement(1162)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1234609887"
     variation       complement(1165)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1267737282"
     variation       complement(1166)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1028337269"
     variation       complement(1172)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:994983023"
     variation       complement(1173)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:927330265"
     variation       complement(1178)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:567758209"
     variation       complement(1180)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1294731309"
     variation       complement(1181)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1363595090"
     variation       complement(1182..1203)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace=""
                     /replace="ccgcccgcctcggcc"
                     /db_xref="dbSNP:1404108999"
     variation       complement(1182)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1015015505"
     variation       complement(1184..1198)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace=""
                     /replace="gccggccgccaccag"
                     /db_xref="dbSNP:923797659"
     variation       complement(1187)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1418380270"
     variation       complement(1190)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1014375189"
     variation       complement(1191)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1365574970"
     variation       complement(1199)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:895800359"
     variation       complement(1204)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1471081569"
     variation       complement(1208)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1337757897"
     variation       complement(1211)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1055773416"
     variation       complement(1215)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1032635010"
     variation       complement(1216)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:937351289"
     variation       complement(1219)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1309839906"
     variation       complement(1222)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:570636149"
     variation       complement(1224)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:900268373"
     variation       complement(1225)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:181240194"
     variation       complement(1226)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1367920666"
     variation       complement(1227)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1162748224"
     variation       complement(1228)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:946548908"
     variation       complement(1231)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:891265786"
     variation       complement(1231)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1480209611"
     variation       complement(1232)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1252656332"
     variation       complement(1240)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1262694443"
     variation       complement(1243)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:547807620"
     variation       complement(1250)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1472886386"
     variation       complement(1263)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1464228075"
     variation       complement(1264)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1198703031"
     variation       complement(1274)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1051807990"
     variation       complement(1283)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:536472124"
     polyA_site      1285
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /experiment="experimental evidence, no additional details
                     recorded"
ORIGIN      
ggccccgcgcccggcccgcgccctgcccagtgcggcctcctttccacccgccgctgcctgcccgcgccgtccggcgcccgagctgcccgcgggctgggtccccgcggcccgagccgccccggccgggaccccgaacaaggccgagatgacttccaaggaggacggcaaggcggcgccgggggaggagcggcggcgcagcccgctggaccacctgcctccgcctgccaactccaacaagccactgacgccgttcagcatcgaggacatcctcaacaagccgtctgtgcggagaagttactcgctgtgcggggcggcgcacctgctggccgccgcggacaagcacgcgcagggcggcttgcccctggcgggccgcgcgctgctctcgcagacctcgccgctgtgcgcgctggaggagctcgccagcaagacgtttaaggggctggaggtcagcgttctgcaggcagccgaaggccgcgacggtatgaccatctttgggcagcggcagacccctaagaagcggcgaaagtcgcgcacggccttcaccaaccaccagatctatgaattggaaaagcgctttctataccagaagtacctgtcccccgccgatcgcgaccaaatcgcgcagcagctgggcctcaccaacgcgcaagtcatcacctggttccagaatcggcgcgctaagctcaagcgggacctggaggagatgaaggccgacgtagagtccgccaagaaactgggccccagcgggcagatggacatcgtggcgctggccgaactcgagcagaactcggaggccacagccggcggtggcggcggctgcggcagggccaagtcgaggcccggctctccggtcctccccccaggcgccccgaaggccccgggcgctggcgccctgcagctctcgcctgcctctccgctcacggaccagccggccagcagccaggactgctcggaggacgaggaagacgaagagatcgacgtggacgattgagcggcgccccgggtcttccgccgccctgggctcctagcgctcgaaagcccaacgcctcccggaccggaccgccgaggggagctgggacctcctctgccaactcccgcctcctcccctgtccccggccccggactcggctcctggcagccgcctcttccctctcgaagcaataaacccaggctggccggccgggccggccgccaccagcggcctccgccgccccggaagccctcgccgtgcaattctgtatggcttctatataaatatttaaacctatatagcgggttcttcccaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]