GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-10-17 07:23:32, GGRNA.v2 : RefSeq release 232 (Sep, 2025)

LOCUS       NM_005227               1254 bp    mRNA    linear   PRI 27-APR-2025
DEFINITION  Homo sapiens ephrin A4 (EFNA4), transcript variant 1, mRNA.
ACCESSION   NM_005227
VERSION     NM_005227.3
KEYWORDS    RefSeq; MANE Select.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1254)
  AUTHORS   Yuan,W., Zhao,H., Zhou,A. and Wang,S.
  TITLE     Interference of EFNA4 suppresses cell proliferation, invasion and
            angiogenesis in hepatocellular carcinoma by downregulating PYGO2
  JOURNAL   Cancer Biol Ther 23 (1), 1-12 (2022)
   PUBMED   36404439
  REMARK    GeneRIF: Interference of EFNA4 suppresses cell proliferation,
            invasion and angiogenesis in hepatocellular carcinoma by
            downregulating PYGO2.
REFERENCE   2  (bases 1 to 1254)
  AUTHORS   Kousathanas,A., Pairo-Castineira,E., Rawlik,K., Stuckey,A.,
            Odhams,C.A., Walker,S., Russell,C.D., Malinauskas,T., Wu,Y.,
            Millar,J., Shen,X., Elliott,K.S., Griffiths,F., Oosthuyzen,W.,
            Morrice,K., Keating,S., Wang,B., Rhodes,D., Klaric,L., Zechner,M.,
            Parkinson,N., Siddiq,A., Goddard,P., Donovan,S., Maslove,D.,
            Nichol,A., Semple,M.G., Zainy,T., Maleady-Crowe,F., Todd,L.,
            Salehi,S., Knight,J., Elgar,G., Chan,G., Arumugam,P., Patch,C.,
            Rendon,A., Bentley,D., Kingsley,C., Kosmicki,J.A., Horowitz,J.E.,
            Baras,A., Abecasis,G.R., Ferreira,M.A.R., Justice,A., Mirshahi,T.,
            Oetjens,M., Rader,D.J., Ritchie,M.D., Verma,A., Fowler,T.A.,
            Shankar-Hari,M., Summers,C., Hinds,C., Horby,P., Ling,L.,
            McAuley,D., Montgomery,H., Openshaw,P.J.M., Elliott,P., Walsh,T.,
            Tenesa,A., Fawkes,A., Murphy,L., Rowan,K., Ponting,C.P., Vitart,V.,
            Wilson,J.F., Yang,J., Bretherick,A.D., Scott,R.H., Hendry,S.C.,
            Moutsianas,L., Law,A., Caulfield,M.J. and Baillie,J.K.
  CONSRTM   GenOMICC investigators; 23andMe investigators; COVID-19 Human
            Genetics Initiative
  TITLE     Whole-genome sequencing reveals host factors underlying critical
            COVID-19
  JOURNAL   Nature 607 (7917), 97-103 (2022)
   PUBMED   35255492
REFERENCE   3  (bases 1 to 1254)
  AUTHORS   Huttlin,E.L., Bruckner,R.J., Navarrete-Perea,J., Cannon,J.R.,
            Baltier,K., Gebreab,F., Gygi,M.P., Thornock,A., Zarraga,G., Tam,S.,
            Szpyt,J., Gassaway,B.M., Panov,A., Parzen,H., Fu,S., Golbazi,A.,
            Maenpaa,E., Stricker,K., Guha Thakurta,S., Zhang,T., Rad,R.,
            Pan,J., Nusinow,D.P., Paulo,J.A., Schweppe,D.K., Vaites,L.P.,
            Harper,J.W. and Gygi,S.P.
  TITLE     Dual proteome-scale networks reveal cell-specific remodeling of the
            human interactome
  JOURNAL   Cell 184 (11), 3022-3040 (2021)
   PUBMED   33961781
REFERENCE   4  (bases 1 to 1254)
  AUTHORS   Chen,Y.L., Yen,Y.C., Jang,C.W., Wang,S.H., Huang,H.T., Chen,C.H.,
            Hsiao,J.R., Chang,J.Y. and Chen,Y.W.
  TITLE     Ephrin A4-ephrin receptor A10 signaling promotes cell migration and
            spheroid formation by upregulating NANOG expression in oral
            squamous cell carcinoma cells
  JOURNAL   Sci Rep 11 (1), 644 (2021)
   PUBMED   33436772
  REMARK    GeneRIF: Ephrin A4-ephrin receptor A10 signaling promotes cell
            migration and spheroid formation by upregulating NANOG expression
            in oral squamous cell carcinoma cells.
            Publication Status: Online-Only
REFERENCE   5  (bases 1 to 1254)
  AUTHORS   Luck,K., Kim,D.K., Lambourne,L., Spirohn,K., Begg,B.E., Bian,W.,
            Brignall,R., Cafarelli,T., Campos-Laborie,F.J., Charloteaux,B.,
            Choi,D., Cote,A.G., Daley,M., Deimling,S., Desbuleux,A., Dricot,A.,
            Gebbia,M., Hardy,M.F., Kishore,N., Knapp,J.J., Kovacs,I.A.,
            Lemmens,I., Mee,M.W., Mellor,J.C., Pollis,C., Pons,C.,
            Richardson,A.D., Schlabach,S., Teeking,B., Yadav,A., Babor,M.,
            Balcha,D., Basha,O., Bowman-Colin,C., Chin,S.F., Choi,S.G.,
            Colabella,C., Coppin,G., D'Amata,C., De Ridder,D., De Rouck,S.,
            Duran-Frigola,M., Ennajdaoui,H., Goebels,F., Goehring,L., Gopal,A.,
            Haddad,G., Hatchi,E., Helmy,M., Jacob,Y., Kassa,Y., Landini,S.,
            Li,R., van Lieshout,N., MacWilliams,A., Markey,D., Paulson,J.N.,
            Rangarajan,S., Rasla,J., Rayhan,A., Rolland,T., San-Miguel,A.,
            Shen,Y., Sheykhkarimli,D., Sheynkman,G.M., Simonovsky,E., Tasan,M.,
            Tejeda,A., Tropepe,V., Twizere,J.C., Wang,Y., Weatheritt,R.J.,
            Weile,J., Xia,Y., Yang,X., Yeger-Lotem,E., Zhong,Q., Aloy,P.,
            Bader,G.D., De Las Rivas,J., Gaudet,S., Hao,T., Rak,J.,
            Tavernier,J., Hill,D.E., Vidal,M., Roth,F.P. and Calderwood,M.A.
  TITLE     A reference map of the human binary protein interactome
  JOURNAL   Nature 580 (7803), 402-408 (2020)
   PUBMED   32296183
REFERENCE   6  (bases 1 to 1254)
  AUTHORS   Zhou,R.
  TITLE     The Eph family receptors and ligands
  JOURNAL   Pharmacol Ther 77 (3), 151-181 (1998)
   PUBMED   9576626
  REMARK    Review article
REFERENCE   7  (bases 1 to 1254)
  AUTHORS   Flanagan,J.G. and Vanderhaeghen,P.
  TITLE     The ephrins and Eph receptors in neural development
  JOURNAL   Annu Rev Neurosci 21, 309-345 (1998)
   PUBMED   9530499
  REMARK    Review article
REFERENCE   8  (bases 1 to 1254)
  AUTHORS   Gale,N.W., Holland,S.J., Valenzuela,D.M., Flenniken,A., Pan,L.,
            Ryan,T.E., Henkemeyer,M., Strebhardt,K., Hirai,H., Wilkinson,D.G.,
            Pawson,T., Davis,S. and Yancopoulos,G.D.
  TITLE     Eph receptors and ligands comprise two major specificity subclasses
            and are reciprocally compartmentalized during embryogenesis
  JOURNAL   Neuron 17 (1), 9-19 (1996)
   PUBMED   8755474
REFERENCE   9  (bases 1 to 1254)
  AUTHORS   Cerretti,D.P., Lyman,S.D., Kozlosky,C.J., Copeland,N.G.,
            Gilbert,D.J., Jenkins,N.A., Valentine,V., Kirstein,M.N.,
            Shapiro,D.N. and Morris,S.W.
  TITLE     The genes encoding the eph-related receptor tyrosine kinase ligands
            LERK-1 (EPLG1, Epl1), LERK-3 (EPLG3, Epl3), and LERK-4 (EPLG4,
            Epl4) are clustered on human chromosome 1 and mouse chromosome 3
  JOURNAL   Genomics 33 (2), 277-282 (1996)
   PUBMED   8660976
REFERENCE   10 (bases 1 to 1254)
  AUTHORS   Kozlosky,C.J., Maraskovsky,E., McGrew,J.T., VandenBos,T., Teepe,M.,
            Lyman,S.D., Srinivasan,S., Fletcher,F.A., Gayle,R.B. 3rd,
            Cerretti,D.P. et al.
  TITLE     Ligands for the receptor tyrosine kinases hek and elk: isolation of
            cDNAs encoding a family of proteins
  JOURNAL   Oncogene 10 (2), 299-306 (1995)
   PUBMED   7838529
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from CD671399.1, BE780161.1,
            AI459151.1 and BQ940212.1.
            This sequence is a reference standard in the RefSeqGene project.
            
            On Nov 22, 2018 this sequence version replaced NM_005227.2.
            
            Summary: This gene encodes a member of the ephrin (EPH) family. The
            ephrins and EPH-related receptors comprise the largest subfamily of
            receptor protein-tyrosine kinases and have been implicated in
            mediating developmental events, especially in the nervous system
            and in erythropoiesis. Based on their structures and sequence
            relationships, ephrins are divided into the ephrin-A (EFNA) class,
            which are anchored to the membrane by a
            glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB)
            class, which are transmembrane proteins. This gene encodes an EFNA
            class ephrin that has been implicated in proliferation and
            metastasis of several types of cancers. [provided by RefSeq, May
            2022].
            
            Transcript Variant: This variant (1), also known as ephrin-A4 (m),
            is the longest transcript and it encodes isoform a. Isoform a is a
            membrane-bound protein.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: ERR279825.9236.1,
                                           SRR1163658.260846.1 [ECO:0000332]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            coronavirus related    :: locus in the vicinity of
                                      disease-associated variant(s)
            MANE Ensembl match     :: ENST00000368409.8/ ENSP00000357394.3
            RefSeq Select criteria :: based on conservation, expression
            ##RefSeq-Attributes-END##
            COMPLETENESS: full length.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-583               CD671399.1         10-592
            584-1074            BE780161.1         141-631
            1075-1249           AI459151.1         16-190              c
            1250-1254           BQ940212.1         477-481
FEATURES             Location/Qualifiers
     source          1..1254
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="1"
                     /map="1q21.3"
     gene            1..1254
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /note="ephrin A4"
                     /db_xref="GeneID:1945"
                     /db_xref="HGNC:HGNC:3224"
                     /db_xref="MIM:601380"
     exon            1..197
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /inference="alignment:Splign:2.1.0"
     variation       1
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1571648074"
     variation       2
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1056175760"
     variation       3
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:539593653"
     variation       4
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:949761401"
     variation       5
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526434714"
     variation       8
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526434733"
     variation       9
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1044174413"
     variation       10
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:905998730"
     variation       11
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:941502694"
     variation       12
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526434816"
     variation       13..15
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="t"
                     /replace="tgt"
                     /db_xref="dbSNP:1662879747"
     variation       13
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1464119917"
     variation       14
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1002230"
     variation       15
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526434877"
     variation       16
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1571648146"
     variation       17
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1170853712"
     variation       18
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369610690"
     variation       19
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526434979"
     variation       21..26
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="tc"
                     /replace="tctctc"
                     /db_xref="dbSNP:964695884"
     variation       21
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:2526434988"
     variation       22
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1182087715"
     variation       25
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2102437167"
     variation       26
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:897387079"
     variation       27
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526435060"
     variation       28
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1662881223"
     variation       29
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1558137938"
     variation       30
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:994855515"
     variation       32
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1662881720"
     variation       33
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526435123"
     variation       34
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1433143254"
     variation       35
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1662881992"
     variation       36..37
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace=""
                     /replace="ga"
                     /db_xref="dbSNP:2526435178"
     variation       36
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2526435169"
     variation       38
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526435185"
     variation       40
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1662882112"
     variation       41
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1322365129"
     variation       42
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1365659493"
     variation       43
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1051079881"
     variation       44
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1282376546"
     variation       45
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1358327937"
     variation       46..48
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="ggg"
                     /replace="gggg"
                     /db_xref="dbSNP:1181310223"
     variation       46
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1662883179"
     variation       47
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526435286"
     variation       48
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:955424484"
     variation       49
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1228436701"
     variation       51
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526435311"
     variation       52
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:750018113"
     variation       53..62
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="gccaggccag"
                     /replace="gccaggccaggccag"
                     /db_xref="dbSNP:1253948957"
     variation       53
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1463310416"
     variation       54
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:958220768"
     variation       55
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1248187187"
     variation       56
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526435387"
     variation       58
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526435398"
     variation       59..60
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:1662884907"
     variation       59
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1219973346"
     variation       60
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:988198140"
     variation       62
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:758048320"
     variation       64
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:779821500"
     variation       67
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:914050693"
     variation       68
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:2526435467"
     variation       69
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:946855865"
     variation       71
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1163962401"
     variation       72
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526435587"
     variation       73
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1411314602"
     variation       74
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:2526435611"
     variation       75
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1455908012"
     variation       77
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:746766754"
     variation       78..82
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="ggggg"
                     /replace="gggggg"
                     /db_xref="dbSNP:2526435664"
     variation       78
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1662886993"
     variation       81
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2526435677"
     variation       82
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526435696"
     variation       83
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526435709"
     variation       84
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1043928491"
     CDS             85..690
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /note="isoform a precursor is encoded by transcript
                     variant 1; ligand of eph-related kinase 4; eph-related
                     receptor tyrosine kinase ligand 4"
                     /codon_start=1
                     /product="ephrin-A4 isoform a precursor"
                     /protein_id="NP_005218.1"
                     /db_xref="CCDS:CCDS1089.1"
                     /db_xref="GeneID:1945"
                     /db_xref="HGNC:HGNC:3224"
                     /db_xref="MIM:601380"
                     /translation="
MRLLPLLRTVLWAAFLGSPLRGGSSLRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPHYEGPGPPEGPETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSLGFEFLPGETYYYISVPTPESSGQCLRLQVSVCCKERKSESAHPVGSPGESGTSGWRGGDTPSPLCLLLLLLLLILRLLRIL"
     sig_peptide     85..159
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /note="/evidence=ECO:0000269|PubMed:15340161; propagated
                     from UniProtKB/Swiss-Prot (P52798.1)"
     mat_peptide     160..594
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /product="Ephrin-A4. /id=PRO_0000008373"
                     /note="propagated from UniProtKB/Swiss-Prot (P52798.1)"
     misc_feature    163..540
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /note="Ectodomain of Ephrin A; Region:
                     Ephrin-A_Ectodomain; cd10425"
                     /db_xref="CDD:259896"
     misc_feature    181..183
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /note="N-linked (GlcNAc...) asparagine.
                     /evidence=ECO:0000255; propagated from
                     UniProtKB/Swiss-Prot (P52798.1); glycosylation site"
     misc_feature    order(241..243,364..378,403..408,427..444,448..453)
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /note="receptor binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:259896"
     variation       85
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1662887221"
     variation       86
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526435765"
     variation       87
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:754852081"
     variation       88
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:926859436"
     variation       89
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2102437399"
     variation       90
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526435840"
     variation       92
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:938282528"
     variation       93
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2526435857"
     variation       94
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526435869"
     variation       95
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526435880"
     variation       96
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526435891"
     variation       98
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1448650572"
     variation       99
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1429093184"
     variation       100
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2102437421"
     variation       101
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1278509153"
     variation       102
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526435961"
     variation       104
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526435973"
     variation       105
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526435993"
     variation       106
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526436004"
     variation       107
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1326461416"
     variation       108
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:780960543"
     variation       109
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1553267248"
     variation       110
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:2526436060"
     variation       111
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526436072"
     variation       112
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1403415249"
     variation       113
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1662888815"
     variation       114
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526436110"
     variation       115
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:891128045"
     variation       116
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526436130"
     variation       117
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:12760718"
     variation       119
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526436171"
     variation       121
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1349674156"
     variation       122
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526436197"
     variation       123
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526436209"
     variation       124
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1006894326"
     variation       125
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1322354491"
     variation       126
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:111269205"
     variation       131
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526436266"
     variation       132
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1662889826"
     variation       133
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1254487338"
     variation       134
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:868405546"
     variation       135
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2526436323"
     variation       137
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1444693034"
     variation       138
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1662890317"
     variation       139
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526436384"
     variation       140
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:968141432"
     variation       142
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:771087028"
     variation       144
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1157743046"
     variation       145
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:2526436433"
     variation       146
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:865897803"
     variation       147
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:774589466"
     variation       148..152
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="gggg"
                     /replace="ggggg"
                     /db_xref="dbSNP:2526436480"
     variation       148
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526436462"
     variation       149
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1471660146"
     variation       150
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1184386171"
     variation       151
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1662891331"
     variation       152
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1413024884"
     variation       153
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1414009017"
     variation       154
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:746026404"
     variation       155
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:772406343"
     variation       156
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526436595"
     variation       157
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1033285451"
     variation       158
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1662892512"
     variation       159
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1197207739"
     variation       160
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:2526436645"
     variation       161
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1232431969"
     variation       162
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:2526436661"
     variation       163
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1414753641"
     variation       164
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1307352212"
     variation       165
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1348498880"
     variation       167
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:2526436717"
     variation       168
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1411162602"
     variation       169
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1662893318"
     variation       170
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:2526436776"
     variation       171
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:1558138217"
     variation       171
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526436789"
     variation       175
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:896160038"
     variation       176
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1662893722"
     variation       177
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1288397903"
     variation       178
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:543428198"
     variation       179
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526436863"
     variation       180
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526436873"
     variation       181
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:993214956"
     variation       183
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1230597690"
     variation       185..186
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:2526436912"
     variation       185
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2526436905"
     variation       186
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1254696715"
     variation       187
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1347586578"
     variation       188
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1201332848"
     variation       189
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:760930080"
     variation       190..191
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="aa"
                     /db_xref="dbSNP:1662894831"
     variation       191
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526436977"
     variation       192..195
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="cccc"
                     /replace="ccccc"
                     /db_xref="dbSNP:2526437124"
     variation       192
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:764545146"
     variation       193
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526437131"
     variation       194
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1227854348"
     variation       195
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:776966466"
     variation       197
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1290688935"
     exon            198..484
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /inference="alignment:Splign:2.1.0"
     variation       198
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1663054146"
     variation       205
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1391062717"
     variation       206
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:762225853"
     variation       207
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1663054383"
     variation       211
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:770282147"
     variation       213
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:773749190"
     variation       214
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:745549912"
     variation       216
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:146980401"
     variation       217
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:142249822"
     variation       220
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2526456384"
     variation       223
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526456390"
     variation       224
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526456399"
     variation       226
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1242749612"
     variation       227
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1663054982"
     variation       230
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526456425"
     variation       233
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1267281203"
     variation       235
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526456441"
     variation       236
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:927730429"
     variation       237
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369664889"
     variation       238
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:767156779"
     variation       242
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1571653198"
     variation       243
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:780175061"
     variation       244
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1341898292"
     variation       245
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526456514"
     variation       247
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2526456524"
     variation       250
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526456534"
     variation       251
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1215432400"
     variation       252..257
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="tg"
                     /replace="tgtctg"
                     /db_xref="dbSNP:1466098975"
     variation       253
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526456552"
     variation       255
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2526456561"
     variation       256
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526456569"
     variation       257
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526456579"
     variation       258..262
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="ccccc"
                     /replace="cccccc"
                     /db_xref="dbSNP:2526456593"
     variation       258
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526456585"
     variation       259
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:752523859"
     variation       261
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1663055861"
     variation       262
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:148289726"
     variation       263
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199992371"
     variation       265
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1166365914"
     variation       267
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:542869546"
     variation       268
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:780190233"
     variation       269
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526456664"
     variation       270
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526456673"
     variation       271
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2526456679"
     variation       274
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2526456697"
     variation       276
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526456701"
     variation       277..279
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="gg"
                     /replace="ggg"
                     /db_xref="dbSNP:2526456716"
     variation       277
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2102443103"
     variation       278
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370756589"
     variation       279
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:781461644"
     variation       280..284
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="ccccc"
                     /replace="cccccc"
                     /replace="ccccccc"
                     /db_xref="dbSNP:775997490"
     variation       280
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:199831867"
     variation       281
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199824664"
     variation       282
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:773661006"
     variation       283
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1663057149"
     variation       284..285
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace=""
                     /replace="ct"
                     /db_xref="dbSNP:2526456774"
     variation       284
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1553267556"
     variation       285..289
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace=""
                     /replace="tgagg"
                     /db_xref="dbSNP:1663057416"
     variation       285
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:764503763"
     variation       286
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2102443149"
     variation       287
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:2526456794"
     variation       287
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526456792"
     variation       288
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1663057497"
     variation       289
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526456808"
     variation       290
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1240867561"
     variation       292
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2526456824"
     variation       294
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:763481245"
     variation       295
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:770278541"
     variation       296
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:773922536"
     variation       298
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:754285540"
     variation       298
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:2526456860"
     variation       299
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201078911"
     variation       300
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:541082385"
     variation       306
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:2526456883"
     variation       309
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2102443179"
     variation       310
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1266496575"
     variation       312
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526456900"
     variation       313
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:138277393"
     variation       314..319
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="tgg"
                     /replace="tggtgg"
                     /db_xref="dbSNP:2526456924"
     variation       314
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1663058284"
     variation       315
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:760519955"
     variation       316
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526456945"
     variation       318
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1255181016"
     variation       319..323
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="gactg"
                     /db_xref="dbSNP:2526456958"
     variation       321
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:774979817"
     variation       324
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:753765092"
     variation       326
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:368247612"
     variation       327
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:778775987"
     variation       328
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:997960767"
     variation       329
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1179332137"
     variation       330
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:2526457031"
     variation       330
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1244820785"
     variation       331..333
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="t"
                     /replace="tat"
                     /replace="tatat"
                     /db_xref="dbSNP:1413766725"
     variation       333
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:370806650"
     variation       334
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201123791"
     variation       335
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1663059303"
     variation       336
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2102443247"
     variation       337
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:2526457094"
     variation       338
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:200677884"
     variation       339
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526457104"
     variation       340
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1663059534"
     variation       342
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1464802967"
     variation       344
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1359699711"
     variation       345
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375400864"
     variation       347
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1663060007"
     variation       349
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1663060083"
     variation       350
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="actcata"
                     /db_xref="dbSNP:1476256817"
     variation       351
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1663060334"
     variation       352..353
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace=""
                     /replace="ca"
                     /db_xref="dbSNP:1168173419"
     variation       353
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1431141714"
     variation       354..358
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="ccccc"
                     /replace="cccccc"
                     /db_xref="dbSNP:758089508"
     variation       354
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1004443861"
     variation       355
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:2526457212"
     variation       356
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1407731922"
     variation       358
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1558139918"
     variation       359..361
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="ggg"
                     /replace="gggg"
                     /db_xref="dbSNP:766100897"
     variation       359
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:142999275"
     variation       361
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526457323"
     variation       362
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1409322528"
     variation       364
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1286500741"
     variation       365
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1663061730"
     variation       366
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1663061841"
     variation       368
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1663061959"
     variation       369
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1352621818"
     variation       370
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:778114973"
     variation       371
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:749698866"
     variation       372
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1663062544"
     variation       373
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1310232406"
     variation       374..376
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="gg"
                     /replace="ggg"
                     /db_xref="dbSNP:1663062844"
     variation       376
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2526457499"
     variation       377
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:2526457517"
     variation       377
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:2526457508"
     variation       378
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1416250899"
     variation       380
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526457537"
     variation       381
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:544929070"
     variation       383..384
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="cc"
                     /replace="tt"
                     /db_xref="dbSNP:866104265"
     variation       387
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:953962875"
     variation       388..389
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="cc"
                     /replace="cctttcgctcc"
                     /db_xref="dbSNP:1663064354"
     variation       388
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1663064257"
     variation       391
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1280989380"
     variation       395
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2526457712"
     variation       399
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:774783548"
     variation       403
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:989804173"
     variation       405
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1663064628"
     variation       408
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1663064704"
     variation       409
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1663064781"
     variation       411
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:563226989"
     variation       414
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526457758"
     variation       416
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1663064999"
     variation       417
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:966768645"
     variation       420
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1253329399"
     variation       423..426
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="gc"
                     /replace="gcgc"
                     /db_xref="dbSNP:2526457788"
     variation       424
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368795287"
     variation       425
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:775247787"
     variation       426
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526457821"
     variation       431
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1422554226"
     variation       432
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1663065651"
     variation       433..435
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="ccc"
                     /replace="cccc"
                     /db_xref="dbSNP:2526457861"
     variation       433
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:143886639"
     variation       434
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1663065922"
     variation       439
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:776556253"
     variation       440
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1256233082"
     variation       441
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526457889"
     variation       444
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:761582524"
     variation       445
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:765191806"
     variation       447
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:750377879"
     variation       450
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1372491408"
     variation       453
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2526457925"
     variation       456
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:114301457"
     variation       458
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526457948"
     variation       459
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:767615043"
     variation       460
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1365701872"
     variation       463..464
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="gg"
                     /db_xref="dbSNP:1220776337"
     variation       464..469
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="gaga"
                     /replace="gagaga"
                     /db_xref="dbSNP:2526457990"
     variation       464
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526457981"
     variation       469..475
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="act"
                     /replace="acttact"
                     /db_xref="dbSNP:2526458000"
     variation       469
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1663067062"
     variation       470
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:752848379"
     variation       471
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526458019"
     variation       473
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="aa"
                     /db_xref="dbSNP:2526458040"
     variation       473
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1291203787"
     variation       474
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1341436553"
     variation       475
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1663067363"
     variation       476
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:756341656"
     variation       477
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:778025181"
     variation       478
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526458134"
     variation       479
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1663067981"
     variation       480
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2102443491"
     variation       482
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1437922306"
     variation       484
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1663068132"
     exon            485..553
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /inference="alignment:Splign:2.1.0"
     variation       485
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1213932996"
     variation       486
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:151179474"
     variation       487
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1663077376"
     variation       489
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526459832"
     variation       492
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:41264287"
     variation       493
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1464742957"
     variation       495
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526459886"
     variation       496
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526459895"
     variation       497
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526459905"
     variation       499
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1187019544"
     variation       501
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:764267914"
     variation       502..504
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace=""
                     /replace="agt"
                     /db_xref="dbSNP:2526459937"
     variation       503
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526459945"
     variation       505..506
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace=""
                     /replace="gggca"
                     /db_xref="dbSNP:2526459950"
     variation       506
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201670234"
     variation       508
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526459962"
     variation       509
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2102443869"
     variation       513
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:757589642"
     variation       515
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1663077888"
     variation       517
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:141223577"
     variation       519
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:908106668"
     variation       521
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:746332488"
     variation       522
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142288768"
     variation       524
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526460030"
     variation       525
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1463020576"
     variation       528
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1663078385"
     variation       529
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2526460058"
     variation       530
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1663078450"
     variation       533
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526460074"
     variation       534..536
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="t"
                     /replace="tgt"
                     /db_xref="dbSNP:1241165316"
     variation       534
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="t"
                     /replace="tt"
                     /db_xref="dbSNP:1663078516"
     variation       535
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:780776065"
     variation       537
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:746489131"
     variation       538
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1447360049"
     variation       539
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:768333356"
     variation       543
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526460121"
     variation       547
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:780848551"
     variation       551
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526460181"
     variation       552
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526460198"
     exon            554..1254
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /inference="alignment:Splign:2.1.0"
     variation       555
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:199918580"
     variation       556
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:2526465029"
     variation       558
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526465034"
     variation       560
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1571655383"
     variation       562
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:2526465041"
     variation       566
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526465047"
     variation       568
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:768509605"
     variation       569
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1558140980"
     variation       571
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:2526465065"
     variation       572
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1364547456"
     variation       574
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:749049587"
     variation       575
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:947930391"
     variation       576
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1377253307"
     variation       577
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1227349220"
     variation       578
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:770758406"
     variation       581
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1316953642"
     variation       582
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1306944399"
     variation       584
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1368166854"
     variation       586..587
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="gg"
                     /db_xref="dbSNP:2526465126"
     variation       587
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1392568046"
     variation       589
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2526465135"
     variation       591
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:532664020"
     variation       592
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1330109316"
     variation       593
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:544709911"
     variation       595
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369650636"
     variation       596
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1350761562"
     variation       599
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373255071"
     variation       602
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2526465171"
     variation       603
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526465179"
     variation       608
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:776565011"
     variation       610
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:762021782"
     variation       611
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:765348941"
     variation       612
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1558141034"
     variation       613..619
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="gggggg"
                     /replace="ggggggg"
                     /replace="gggggggg"
                     /db_xref="dbSNP:754580525"
     variation       613
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:750724541"
     variation       614
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:763362644"
     variation       615
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:766881827"
     variation       616
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526465254"
     variation       617
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1345844365"
     variation       618
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1382173375"
     variation       619
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:755453194"
     variation       620
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:768127638"
     variation       621
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1454499610"
     variation       622
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:148918689"
     variation       623
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:755687996"
     variation       625
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:562789584"
     variation       626
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526465323"
     variation       627
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:777266611"
     variation       629
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526465331"
     variation       630
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:748959343"
     variation       631
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:757001752"
     variation       632
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201292405"
     variation       633
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:778681147"
     variation       634
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:377230773"
     variation       636
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1425095316"
     variation       638
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526465363"
     variation       639
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:745724420"
     variation       642
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:771903489"
     variation       645
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:775539887"
     variation       646
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:887728687"
     variation       647
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1663117107"
     variation       649
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526465415"
     variation       650
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526465424"
     variation       651
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:941684493"
     variation       652
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2526465439"
     variation       658
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526465445"
     variation       660
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:202221214"
     variation       664
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1663117295"
     variation       665..666
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="tt"
                     /replace="ttt"
                     /db_xref="dbSNP:1355994737"
     variation       666
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526465474"
     variation       667
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:142837088"
     variation       669
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1255054162"
     variation       670
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:769941477"
     variation       671
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:200331554"
     variation       672..677
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="tct"
                     /replace="tcttct"
                     /db_xref="dbSNP:1663117807"
     variation       674
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:145129032"
     variation       676
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2526465546"
     variation       678
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526465556"
     variation       679
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:760012398"
     variation       680
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:759971147"
     variation       683..684
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="t"
                     /replace="tt"
                     /db_xref="dbSNP:748031667"
     variation       683
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1663118121"
     variation       684
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1455877691"
     variation       686..689
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="tg"
                     /replace="tgtg"
                     /db_xref="dbSNP:1166665924"
     variation       687
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:753295258"
     variation       689..691
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="gag"
                     /db_xref="dbSNP:756079308"
     variation       689
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526465605"
     variation       691
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1663118493"
     variation       698
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1320275678"
     variation       699
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2526465627"
     variation       701..702
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:760995989"
     variation       701
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1384413083"
     variation       702
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199947288"
     variation       705
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2526465665"
     variation       706
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1339957778"
     variation       707..711
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="ctc"
                     /replace="ctctc"
                     /db_xref="dbSNP:1558141164"
     variation       707
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1017969863"
     variation       708
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526465687"
     variation       709
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:567168153"
     variation       710
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2102445596"
     variation       711
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1553267703"
     variation       714
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:201215681"
     variation       716
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:758266087"
     variation       717
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1663119483"
     variation       721
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526465740"
     variation       722
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:2526465749"
     variation       722
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:779807669"
     variation       724
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:202246914"
     variation       725
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:773440754"
     variation       726
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2526465768"
     variation       727
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:749132073"
     variation       727
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1663119892"
     variation       728
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1558141212"
     variation       729..736
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace=""
                     /replace="tcctccca"
                     /db_xref="dbSNP:771046983"
     variation       731
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1663120130"
     variation       733
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526465814"
     variation       734
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526465821"
     variation       735
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526465828"
     variation       736
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:749435869"
     variation       737
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:771274591"
     variation       741
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526465857"
     variation       744..745
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace=""
                     /replace="ca"
                     /db_xref="dbSNP:774703301"
     variation       745
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:1558141229"
     variation       745
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:774753006"
     variation       749
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1663120523"
     variation       751
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1553267706"
     variation       752..753
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="gg"
                     /db_xref="dbSNP:746080148"
     variation       756
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:759796184"
     variation       757
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2526465926"
     variation       759
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526465932"
     variation       760
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1472051023"
     variation       762
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1158978226"
     variation       763
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:767943701"
     variation       766
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1455615031"
     variation       767
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:889300332"
     variation       771
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:775818108"
     variation       773
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1170496887"
     variation       775
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="t"
                     /replace="tt"
                     /db_xref="dbSNP:2526465989"
     variation       776..780
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="ggggg"
                     /replace="gggggg"
                     /db_xref="dbSNP:772130989"
     variation       777
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526466014"
     variation       779
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526466021"
     variation       780
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526466028"
     variation       781
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1402072773"
     variation       782
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2102445698"
     variation       785..786
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace=""
                     /replace="aa"
                     /db_xref="dbSNP:775733013"
     variation       786
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1571655799"
     variation       789
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:761244893"
     variation       790
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:763533997"
     variation       792
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:2526466095"
     variation       793
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1663121737"
     variation       794
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1228015744"
     variation       795
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1021875220"
     variation       797
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:748113318"
     variation       798
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526466141"
     variation       799
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1663122081"
     variation       802
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526466152"
     variation       803..804
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="gg"
                     /db_xref="dbSNP:1216183664"
     variation       804
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1663122196"
     variation       809
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:772048174"
     variation       812
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526466214"
     variation       814
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1484635748"
     variation       816
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2526466235"
     variation       818
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:761356922"
     variation       820
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:552355758"
     variation       821
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1031690866"
     variation       823
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:960070810"
     variation       827
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:750115905"
     variation       830
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526466274"
     variation       833
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:758090033"
     variation       834
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:2526466284"
     variation       836
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526466297"
     variation       837
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526466300"
     variation       840..843
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="ct"
                     /replace="ctct"
                     /db_xref="dbSNP:2526466312"
     variation       841
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:2526466320"
     variation       844
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:916014726"
     variation       845
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1472197427"
     variation       846
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:779905284"
     variation       847
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1421280494"
     variation       849
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1553267728"
     variation       850
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1160251060"
     variation       852
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:570670486"
     variation       855
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:915184543"
     variation       857
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1314920375"
     variation       859..862
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="cctc"
                     /db_xref="dbSNP:2526466410"
     variation       860
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2526466417"
     variation       862
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1663123547"
     variation       863
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1158480020"
     variation       864
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2102445821"
     variation       865
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1663123675"
     variation       866
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526466458"
     variation       867
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2526466467"
     variation       869
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1558141354"
     variation       870
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526466486"
     variation       874..880
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="aaga"
                     /replace="aagaaga"
                     /db_xref="dbSNP:761223567"
     variation       875
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1409227720"
     variation       881
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526466517"
     variation       882
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:751395056"
     variation       884
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526466538"
     variation       886
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1663124021"
     variation       888
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1375754714"
     variation       891
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1204969278"
     variation       892
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:754953222"
     variation       893
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:781344227"
     variation       895
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526466585"
     variation       896
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2526466591"
     variation       897
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1345719917"
     variation       899
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:749345800"
     variation       900
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526466629"
     variation       901..904
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="ct"
                     /replace="ctct"
                     /db_xref="dbSNP:1226859582"
     variation       901
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1382096108"
     variation       904
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526466647"
     variation       905..920
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="gaagcagaggcaagac"
                     /replace="gaagcagaggcaagacgaagcagaggcaagac"
                     /db_xref="dbSNP:2526466651"
     variation       907
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526466658"
     variation       913
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1280886339"
     variation       914
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:771183074"
     variation       915
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:779226711"
     variation       917
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1663124751"
     variation       918
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:746129864"
     variation       919
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526466706"
     variation       920
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1057273721"
     variation       923..927
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="aca"
                     /replace="acaca"
                     /db_xref="dbSNP:764734484"
     variation       926
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1663125039"
     variation       930
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:981034397"
     variation       931
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:909117055"
     variation       932
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1663125260"
     variation       934
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1162226299"
     variation       938
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526466815"
     variation       939
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2526466823"
     variation       940
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1404452992"
     variation       945
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2102445922"
     variation       946
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:2526466834"
     variation       951
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526466841"
     variation       952
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:897335499"
     variation       953
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1571655973"
     variation       957
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:941954387"
     variation       959
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526466864"
     variation       960
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526466868"
     variation       961
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526466875"
     variation       964
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526466880"
     variation       965
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:112399433"
     variation       966
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1571655986"
     variation       967
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1663125748"
     variation       968
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1663125800"
     variation       969
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:2526466939"
     variation       973
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526466942"
     variation       974
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526466949"
     variation       976..977
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace=""
                     /replace="ct"
                     /db_xref="dbSNP:1237514676"
     variation       976
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1663125846"
     variation       977
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:888731911"
     variation       978
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:538384115"
     variation       979
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1006507102"
     variation       981
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526466971"
     variation       982
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526466981"
     variation       983
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526466985"
     variation       984
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526466991"
     variation       987
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526466996"
     variation       988
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526467002"
     variation       989
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:2526467010"
     variation       992
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526467013"
     variation       993
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:2526467017"
     variation       995
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:144763497"
     variation       996
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:2526467025"
     variation       999
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1663126180"
     variation       1001
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1219627836"
     variation       1002
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1663126295"
     variation       1003
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1359075712"
     variation       1005
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526467055"
     variation       1006
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:2526467062"
     variation       1008
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1292506153"
     variation       1011..1015
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="gggg"
                     /replace="ggggg"
                     /db_xref="dbSNP:2526467091"
     variation       1011
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2102445976"
     variation       1013
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1663126528"
     variation       1014
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1348896353"
     variation       1016..1018
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="cc"
                     /replace="ccc"
                     /db_xref="dbSNP:2526467115"
     variation       1019
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1213257771"
     variation       1020
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1283668970"
     variation       1021..1022
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace=""
                     /replace="tcttcagcctgggc"
                     /db_xref="dbSNP:2526467140"
     variation       1022
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1663126882"
     variation       1026
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1487835650"
     variation       1029
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526467169"
     variation       1030
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1663127059"
     variation       1032
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:897500547"
     variation       1035
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1663127195"
     variation       1038
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:563813867"
     variation       1039
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526467277"
     variation       1040
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:773104614"
     variation       1041
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2102446017"
     variation       1042
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1663127485"
     variation       1042
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1051454441"
     variation       1043
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:374633006"
     variation       1045
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1663127614"
     variation       1046
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526467357"
     variation       1049
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1365820826"
     variation       1050
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526467401"
     variation       1052
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526467408"
     variation       1053..1054
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:2526467415"
     variation       1054
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:2526467417"
     variation       1055
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1164880029"
     variation       1056
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1417352065"
     variation       1057
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526467434"
     variation       1059
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:2526467441"
     variation       1061..1069
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="aagaag"
                     /replace="aagaagaag"
                     /db_xref="dbSNP:1379195799"
     variation       1063
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:888902933"
     variation       1067
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:956725684"
     variation       1069
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2526467468"
     variation       1070..1072
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="cc"
                     /replace="ccc"
                     /db_xref="dbSNP:989364734"
     variation       1071
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1007708289"
     variation       1072..1073
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace=""
                     /replace="aggct"
                     /db_xref="dbSNP:1663128192"
     variation       1074
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1190413930"
     variation       1076
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1022239988"
     variation       1077
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:2526467527"
     variation       1077
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2526467522"
     variation       1079
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1455348952"
     variation       1085
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:969296951"
     variation       1087
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="t"
                     /replace="tt"
                     /db_xref="dbSNP:1663128555"
     variation       1088
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:904745993"
     variation       1089
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526467642"
     variation       1093
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1224767589"
     variation       1095..1098
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="ttt"
                     /replace="tttt"
                     /db_xref="dbSNP:2526467657"
     variation       1095
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1663128731"
     variation       1100
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526467660"
     variation       1102
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1487333217"
     variation       1103
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526467671"
     variation       1106
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:759728514"
     variation       1109
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2526467680"
     variation       1110
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:2526467689"
     variation       1112
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1156430098"
     variation       1116
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:1663129224"
     variation       1116
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:564877955"
     variation       1119
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1663129286"
     variation       1120
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526467724"
     variation       1121
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526467730"
     variation       1124
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1663129334"
     variation       1128
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1240377298"
     variation       1129
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1319327545"
     variation       1132
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:2526467758"
     variation       1133
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1663129495"
     variation       1134
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1663129542"
     variation       1136
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:775819390"
     variation       1137..1140
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace=""
                     /replace="actt"
                     /db_xref="dbSNP:1223300097"
     variation       1137
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:927294280"
     variation       1138
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1663129834"
     variation       1146
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1663129924"
     variation       1147
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1304546371"
     variation       1148
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1663130022"
     variation       1153
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2526467833"
     variation       1155
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:769750020"
     variation       1156..1157
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="gg"
                     /db_xref="dbSNP:1663130253"
     variation       1156
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:536226496"
     variation       1159
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526467866"
     variation       1160
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2526467876"
     variation       1167
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1663130312"
     variation       1184
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1455222047"
     variation       1188
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1663130422"
     variation       1189
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1375872284"
     variation       1193..1197
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="tttt"
                     /replace="ttttt"
                     /db_xref="dbSNP:2526467909"
     variation       1198
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1057458627"
     variation       1199
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1663130596"
     variation       1200
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2526467952"
     variation       1202
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1663130642"
     variation       1203
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:554241024"
     variation       1206
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1663130752"
     variation       1208
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1663130822"
     variation       1209
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1175030350"
     variation       1210
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1663130949"
     variation       1211
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1480659387"
     variation       1214
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:2526468004"
     variation       1215
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1663131048"
     variation       1216
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:573097675"
     regulatory      1221..1226
                     /regulatory_class="polyA_signal_sequence"
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /note="hexamer: AATAAA"
     variation       1221
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1663131335"
     variation       1222
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1663131390"
     variation       1223
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:930126542"
     variation       1224
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1476999346"
     variation       1227
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1261129343"
     variation       1235
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1663131754"
     variation       1237
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1663131849"
     variation       1239..1244
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="ttg"
                     /replace="ttgttg"
                     /db_xref="dbSNP:1663131940"
     variation       1250
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:2526468095"
     variation       1251
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:540427499"
     variation       1253
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:2526468111"
     polyA_site      1254
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /note="major polyA site"
     variation       1254
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1325361549"
ORIGIN      
ccctcttcactttgtacctttctctcctcgactgtgaagcgggccgggacctgccaggccagaccaaaccggacctcgggggcgatgcggctgctgcccctgctgcggactgtcctctgggccgcgttcctcggctcccctctgcgcgggggctccagcctccgccacgtagtctactggaactccagtaaccccaggttgcttcgaggagacgccgtggtggagctgggcctcaacgattacctagacattgtctgcccccactacgaaggcccagggccccctgagggccccgagacgtttgctttgtacatggtggactggccaggctatgagtcctgccaggcagagggcccccgggcctacaagcgctgggtgtgctccctgccctttggccatgttcaattctcagagaagattcagcgcttcacacccttctccctcggctttgagttcttacctggagagacttactactacatctcggtgcccactccagagagttctggccagtgcttgaggctccaggtgtctgtctgctgcaaggagaggaagtctgagtcagcccatcctgttgggagccctggagagagtggcacatcagggtggcgagggggggacactcccagccccctctgtctcttgctattactgctgcttctgattcttcgtcttctgcgaattctgtgagccaagcagaccttccctctcatcccaaggagccagagtcctcccaagatcccctggaggaggagggatccctgctgcctgcactgggggtgccaattcagaccgacaagatggagcattgatgggggagatcagagggtctgaggtgactcttgcaggagcctgtcccctcatcacaggctaaagaagagcagtagacagccctggacactctgaagcagaggcaagacaaacacaggcgctttgcaggctgctctgagggtctcagcccatcccccaggaggactgggatttggtatgatcaaatcctcaagccagctgggggcccaggctgaagacctggggacaggtcgattgctggaccagggcaaagaagaagccctgccatctgtgccctgtgggccttttccctggggcagcaccttgccctccccaggggatcactcacttgtcttctatgaagacggactcttcatgaggttgaatttcatgccagtttgtatttttataagtatctagaccaaaccttcaataaaccactcatctttttgttgccctccccaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]