ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-07-04 17:24:40, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS NM_001406810 1207 bp mRNA linear PRI 01-MAY-2025
DEFINITION Homo sapiens ephrin A4 (EFNA4), transcript variant 4, mRNA.
ACCESSION NM_001406810
VERSION NM_001406810.1
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1207)
AUTHORS Yuan,W., Zhao,H., Zhou,A. and Wang,S.
TITLE Interference of EFNA4 suppresses cell proliferation, invasion and
angiogenesis in hepatocellular carcinoma by downregulating PYGO2
JOURNAL Cancer Biol Ther 23 (1), 1-12 (2022)
PUBMED 36404439
REMARK GeneRIF: Interference of EFNA4 suppresses cell proliferation,
invasion and angiogenesis in hepatocellular carcinoma by
downregulating PYGO2.
REFERENCE 2 (bases 1 to 1207)
AUTHORS Kousathanas,A., Pairo-Castineira,E., Rawlik,K., Stuckey,A.,
Odhams,C.A., Walker,S., Russell,C.D., Malinauskas,T., Wu,Y.,
Millar,J., Shen,X., Elliott,K.S., Griffiths,F., Oosthuyzen,W.,
Morrice,K., Keating,S., Wang,B., Rhodes,D., Klaric,L., Zechner,M.,
Parkinson,N., Siddiq,A., Goddard,P., Donovan,S., Maslove,D.,
Nichol,A., Semple,M.G., Zainy,T., Maleady-Crowe,F., Todd,L.,
Salehi,S., Knight,J., Elgar,G., Chan,G., Arumugam,P., Patch,C.,
Rendon,A., Bentley,D., Kingsley,C., Kosmicki,J.A., Horowitz,J.E.,
Baras,A., Abecasis,G.R., Ferreira,M.A.R., Justice,A., Mirshahi,T.,
Oetjens,M., Rader,D.J., Ritchie,M.D., Verma,A., Fowler,T.A.,
Shankar-Hari,M., Summers,C., Hinds,C., Horby,P., Ling,L.,
McAuley,D., Montgomery,H., Openshaw,P.J.M., Elliott,P., Walsh,T.,
Tenesa,A., Fawkes,A., Murphy,L., Rowan,K., Ponting,C.P., Vitart,V.,
Wilson,J.F., Yang,J., Bretherick,A.D., Scott,R.H., Hendry,S.C.,
Moutsianas,L., Law,A., Caulfield,M.J. and Baillie,J.K.
CONSRTM GenOMICC investigators; 23andMe investigators; COVID-19 Human
Genetics Initiative
TITLE Whole-genome sequencing reveals host factors underlying critical
COVID-19
JOURNAL Nature 607 (7917), 97-103 (2022)
PUBMED 35255492
REFERENCE 3 (bases 1 to 1207)
AUTHORS Huttlin,E.L., Bruckner,R.J., Navarrete-Perea,J., Cannon,J.R.,
Baltier,K., Gebreab,F., Gygi,M.P., Thornock,A., Zarraga,G., Tam,S.,
Szpyt,J., Gassaway,B.M., Panov,A., Parzen,H., Fu,S., Golbazi,A.,
Maenpaa,E., Stricker,K., Guha Thakurta,S., Zhang,T., Rad,R.,
Pan,J., Nusinow,D.P., Paulo,J.A., Schweppe,D.K., Vaites,L.P.,
Harper,J.W. and Gygi,S.P.
TITLE Dual proteome-scale networks reveal cell-specific remodeling of the
human interactome
JOURNAL Cell 184 (11), 3022-3040 (2021)
PUBMED 33961781
REFERENCE 4 (bases 1 to 1207)
AUTHORS Chen,Y.L., Yen,Y.C., Jang,C.W., Wang,S.H., Huang,H.T., Chen,C.H.,
Hsiao,J.R., Chang,J.Y. and Chen,Y.W.
TITLE Ephrin A4-ephrin receptor A10 signaling promotes cell migration and
spheroid formation by upregulating NANOG expression in oral
squamous cell carcinoma cells
JOURNAL Sci Rep 11 (1), 644 (2021)
PUBMED 33436772
REMARK GeneRIF: Ephrin A4-ephrin receptor A10 signaling promotes cell
migration and spheroid formation by upregulating NANOG expression
in oral squamous cell carcinoma cells.
Publication Status: Online-Only
REFERENCE 5 (bases 1 to 1207)
AUTHORS Luck,K., Kim,D.K., Lambourne,L., Spirohn,K., Begg,B.E., Bian,W.,
Brignall,R., Cafarelli,T., Campos-Laborie,F.J., Charloteaux,B.,
Choi,D., Cote,A.G., Daley,M., Deimling,S., Desbuleux,A., Dricot,A.,
Gebbia,M., Hardy,M.F., Kishore,N., Knapp,J.J., Kovacs,I.A.,
Lemmens,I., Mee,M.W., Mellor,J.C., Pollis,C., Pons,C.,
Richardson,A.D., Schlabach,S., Teeking,B., Yadav,A., Babor,M.,
Balcha,D., Basha,O., Bowman-Colin,C., Chin,S.F., Choi,S.G.,
Colabella,C., Coppin,G., D'Amata,C., De Ridder,D., De Rouck,S.,
Duran-Frigola,M., Ennajdaoui,H., Goebels,F., Goehring,L., Gopal,A.,
Haddad,G., Hatchi,E., Helmy,M., Jacob,Y., Kassa,Y., Landini,S.,
Li,R., van Lieshout,N., MacWilliams,A., Markey,D., Paulson,J.N.,
Rangarajan,S., Rasla,J., Rayhan,A., Rolland,T., San-Miguel,A.,
Shen,Y., Sheykhkarimli,D., Sheynkman,G.M., Simonovsky,E., Tasan,M.,
Tejeda,A., Tropepe,V., Twizere,J.C., Wang,Y., Weatheritt,R.J.,
Weile,J., Xia,Y., Yang,X., Yeger-Lotem,E., Zhong,Q., Aloy,P.,
Bader,G.D., De Las Rivas,J., Gaudet,S., Hao,T., Rak,J.,
Tavernier,J., Hill,D.E., Vidal,M., Roth,F.P. and Calderwood,M.A.
TITLE A reference map of the human binary protein interactome
JOURNAL Nature 580 (7803), 402-408 (2020)
PUBMED 32296183
REFERENCE 6 (bases 1 to 1207)
AUTHORS Zhou,R.
TITLE The Eph family receptors and ligands
JOURNAL Pharmacol Ther 77 (3), 151-181 (1998)
PUBMED 9576626
REMARK Review article
REFERENCE 7 (bases 1 to 1207)
AUTHORS Flanagan,J.G. and Vanderhaeghen,P.
TITLE The ephrins and Eph receptors in neural development
JOURNAL Annu Rev Neurosci 21, 309-345 (1998)
PUBMED 9530499
REMARK Review article
REFERENCE 8 (bases 1 to 1207)
AUTHORS Gale,N.W., Holland,S.J., Valenzuela,D.M., Flenniken,A., Pan,L.,
Ryan,T.E., Henkemeyer,M., Strebhardt,K., Hirai,H., Wilkinson,D.G.,
Pawson,T., Davis,S. and Yancopoulos,G.D.
TITLE Eph receptors and ligands comprise two major specificity subclasses
and are reciprocally compartmentalized during embryogenesis
JOURNAL Neuron 17 (1), 9-19 (1996)
PUBMED 8755474
REFERENCE 9 (bases 1 to 1207)
AUTHORS Cerretti,D.P., Lyman,S.D., Kozlosky,C.J., Copeland,N.G.,
Gilbert,D.J., Jenkins,N.A., Valentine,V., Kirstein,M.N.,
Shapiro,D.N. and Morris,S.W.
TITLE The genes encoding the eph-related receptor tyrosine kinase ligands
LERK-1 (EPLG1, Epl1), LERK-3 (EPLG3, Epl3), and LERK-4 (EPLG4,
Epl4) are clustered on human chromosome 1 and mouse chromosome 3
JOURNAL Genomics 33 (2), 277-282 (1996)
PUBMED 8660976
REFERENCE 10 (bases 1 to 1207)
AUTHORS Kozlosky,C.J., Maraskovsky,E., McGrew,J.T., VandenBos,T., Teepe,M.,
Lyman,S.D., Srinivasan,S., Fletcher,F.A., Gayle,R.B. 3rd,
Cerretti,D.P. et al.
TITLE Ligands for the receptor tyrosine kinases hek and elk: isolation of
cDNAs encoding a family of proteins
JOURNAL Oncogene 10 (2), 299-306 (1995)
PUBMED 7838529
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from AL691442.32.
Summary: This gene encodes a member of the ephrin (EPH) family. The
ephrins and EPH-related receptors comprise the largest subfamily of
receptor protein-tyrosine kinases and have been implicated in
mediating developmental events, especially in the nervous system
and in erythropoiesis. Based on their structures and sequence
relationships, ephrins are divided into the ephrin-A (EFNA) class,
which are anchored to the membrane by a
glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB)
class, which are transmembrane proteins. This gene encodes an EFNA
class ephrin that has been implicated in proliferation and
metastasis of several types of cancers. [provided by RefSeq, May
2022].
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: SRR14372080.3010822.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
SAMEA2142680, SAMEA2145240
[ECO:0000348]
##Evidence-Data-END##
##RefSeq-Attributes-START##
coronavirus related :: locus in the vicinity of disease-associated
variant(s)
##RefSeq-Attributes-END##
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-197 AL691442.32 12012-12208
198-316 AL691442.32 12714-12832
317-603 AL691442.32 15002-15288
604-672 AL691442.32 15644-15712
673-1207 AL691442.32 17291-17825
FEATURES Location/Qualifiers
source 1..1207
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="1"
/map="1q21.3"
gene 1..1207
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/note="ephrin A4"
/db_xref="GeneID:1945"
/db_xref="HGNC:HGNC:3224"
/db_xref="MIM:601380"
exon 1..197
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/inference="alignment:Splign:2.1.0"
exon 198..316
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/inference="alignment:Splign:2.1.0"
misc_feature 252..254
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/note="upstream in-frame stop codon"
exon 317..603
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/inference="alignment:Splign:2.1.0"
CDS 432..827
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/note="isoform d is encoded by transcript variant 4;
ligand of eph-related kinase 4; eph-related receptor
tyrosine kinase ligand 4"
/codon_start=1
/product="ephrin-A4 isoform d"
/protein_id="NP_001393739.1"
/db_xref="GeneID:1945"
/db_xref="HGNC:HGNC:3224"
/db_xref="MIM:601380"
/translation="
MVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSLGFEFLPGETYYYISVPTPESSGQCLRLQVSVCCKERRARVLPRSPGGGGIPAACTGGANSDRQDGALMGEIRGSEVTLAGACPLITG"
misc_feature <432..659
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/note="Cupredoxin superfamily; Region: Cupredoxin;
cl19115"
/db_xref="CDD:473140"
exon 604..672
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/inference="alignment:Splign:2.1.0"
exon 673..1207
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/inference="alignment:Splign:2.1.0"
regulatory 1174..1179
/regulatory_class="polyA_signal_sequence"
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/note="hexamer: AATAAA"
polyA_site 1207
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/note="major polyA site"
ORIGIN
ccctcttcactttgtacctttctctcctcgactgtgaagcgggccgggacctgccaggccagaccaaaccggacctcgggggcgatgcggctgctgcccctgctgcggactgtcctctgggccgcgttcctcggctcccctctgcgcgggggctccagcctccgccacgtagtctactggaactccagtaaccccagtgtcagccctgcccttctagccgaatcacctctgggcaagtctcgtgaccttcctaacctcatttatctcacctgtataatgggctaataatacctagtaccctgggaagtctggcagggttgcttcgaggagacgccgtggtggagctgggcctcaacgattacctagacattgtctgcccccactacgaaggcccagggccccctgagggccccgagacgtttgctttgtacatggtggactggccaggctatgagtcctgccaggcagagggcccccgggcctacaagcgctgggtgtgctccctgccctttggccatgttcaattctcagagaagattcagcgcttcacacccttctccctcggctttgagttcttacctggagagacttactactacatctcggtgcccactccagagagttctggccagtgcttgaggctccaggtgtctgtctgctgcaaggagaggagagccagagtcctcccaagatcccctggaggaggagggatccctgctgcctgcactgggggtgccaattcagaccgacaagatggagcattgatgggggagatcagagggtctgaggtgactcttgcaggagcctgtcccctcatcacaggctaaagaagagcagtagacagccctggacactctgaagcagaggcaagacaaacacaggcgctttgcaggctgctctgagggtctcagcccatcccccaggaggactgggatttggtatgatcaaatcctcaagccagctgggggcccaggctgaagacctggggacaggtcgattgctggaccagggcaaagaagaagccctgccatctgtgccctgtgggccttttccctggggcagcaccttgccctccccaggggatcactcacttgtcttctatgaagacggactcttcatgaggttgaatttcatgccagtttgtatttttataagtatctagaccaaaccttcaataaaccactcatctttttgttgccctccccaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]