ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-04-13 22:54:31, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS NM_001397359 3204 bp mRNA linear VRT 30-APR-2025 DEFINITION Gallus gallus LIM homeobox 1 (LHX1), mRNA. ACCESSION NM_001397359 XM_015295682 VERSION NM_001397359.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. REFERENCE 1 (bases 1 to 3204) AUTHORS Tang,H., Finn,R.D. and Thomas,P.D. TITLE TreeGrafter: phylogenetic tree-based annotation of proteins with Gene Ontology terms and other annotations JOURNAL Bioinformatics 35 (3), 518-520 (2019) PUBMED 30032202 REFERENCE 2 (bases 1 to 3204) AUTHORS Shirazi Fard,S., All-Ericsson,C. and Hallbook,F. TITLE The heterogenic final cell cycle of chicken retinal Lim1 horizontal cells is not regulated by the DNA damage response pathway JOURNAL Cell Cycle 13 (3), 408-417 (2014) PUBMED 24247150 REMARK GeneRIF: DNA damage response pathway is functional in the Lim1 horizontal progenitor cells, but that it is not directly involved in the regulation of the final cell cycle that gives rise to the heteroploid horizontal cell population. REFERENCE 3 (bases 1 to 3204) AUTHORS Inoue,J., Ueda,Y., Bando,T., Mito,T., Noji,S. and Ohuchi,H. TITLE The expression of LIM-homeobox genes, Lhx1 and Lhx5, in the forebrain is essential for neural retina differentiation JOURNAL Dev Growth Differ 55 (7), 668-675 (2013) PUBMED 24024588 REMARK GeneRIF: Results suggest that Lhx1 and Lhx5 in the forebrain regulate neural retina differentiation by suppressing the development of the retinal pigment epithelium, before the formation of the optic vesicle (OV). REFERENCE 4 (bases 1 to 3204) AUTHORS Kawaue,T., Okamoto,M., Matsuyo,A., Inoue,J., Ueda,Y., Tomonari,S., Noji,S. and Ohuchi,H. TITLE Lhx1 in the proximal region of the optic vesicle permits neural retina development in the chicken JOURNAL Biol Open 1 (11), 1083-1093 (2012) PUBMED 23213388 REFERENCE 5 (bases 1 to 3204) AUTHORS Burge,S., Kelly,E., Lonsdale,D., Mutowo-Muellenet,P., McAnulla,C., Mitchell,A., Sangrador-Vegas,A., Yong,S.Y., Mulder,N. and Hunter,S. TITLE Manual GO annotation of predictive protein signatures: the InterPro approach to GO curation JOURNAL Database (Oxford) 2012, bar068 (2012) PUBMED 22301074 REMARK Publication Status: Online-Only REFERENCE 6 (bases 1 to 3204) AUTHORS Fukui,A., Yokoo,T., Matsumoto,K., Kawamura,T., Hosoya,T. and Okabe,M. TITLE Integration of human mesenchymal stem cells into the Wolffian duct in chicken embryos JOURNAL Biochem Biophys Res Commun 385 (3), 330-335 (2009) PUBMED 19450546 REFERENCE 7 (bases 1 to 3204) AUTHORS Sun,X., Saitsu,H., Shiota,K. and Ishibashi,M. TITLE Expression dynamics of the LIM-homeobox genes, Lhx1 and Lhx9, in the diencephalon during chick development JOURNAL Int J Dev Biol 52 (1), 33-41 (2008) PUBMED 18033670 REMARK GeneRIF: Expression dynamics of LHX1 in the diencephalon during chick development is reported. REFERENCE 8 (bases 1 to 3204) AUTHORS James,R.G. and Schultheiss,T.M. TITLE Patterning of the avian intermediate mesoderm by lateral plate and axial tissues JOURNAL Dev Biol 253 (1), 109-124 (2003) PUBMED 12490201 REFERENCE 9 (bases 1 to 3204) AUTHORS Sockanathan,S. and Jessell,T.M. TITLE Motor neuron-derived retinoid signaling specifies the subtype identity of spinal motor neurons JOURNAL Cell 94 (4), 503-514 (1998) PUBMED 9727493 REFERENCE 10 (bases 1 to 3204) AUTHORS Tsuchida,T., Ensini,M., Morton,S.B., Baldassare,M., Edlund,T., Jessell,T.M. and Pfaff,S.L. TITLE Topographic organization of embryonic motor neurons defined by expression of LIM homeobox genes JOURNAL Cell 79 (6), 957-970 (1994) PUBMED 7528105 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JAENSK010000323.1. On Nov 9, 2021 this sequence version replaced XM_015295682.3. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: SRR13267662.26010.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA103992393, SAMEA103992482 [ECO:0000348] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-748 JAENSK010000323.1 8375474-8376221 749-975 JAENSK010000323.1 8377032-8377258 976-1253 JAENSK010000323.1 8377362-8377639 1254-1419 JAENSK010000323.1 8377994-8378159 1420-1820 JAENSK010000323.1 8378542-8378942 1821-3204 JAENSK010000323.1 8379020-8380403 FEATURES Location/Qualifiers source 1..3204 /organism="Gallus gallus" /mol_type="mRNA" /db_xref="taxon:9031" /chromosome="19" /map="19" gene 1..3204 /gene="LHX1" /gene_synonym="LIM-1; LIM-homeobox; LIM1" /note="LIM homeobox 1" /db_xref="CGNC:4028" /db_xref="GeneID:396381" exon 1..748 /gene="LHX1" /gene_synonym="LIM-1; LIM-homeobox; LIM1" /inference="alignment:Splign:2.1.0" misc_feature 567..569 /gene="LHX1" /gene_synonym="LIM-1; LIM-homeobox; LIM1" /note="upstream in-frame stop codon" CDS 579..1799 /gene="LHX1" /gene_synonym="LIM-1; LIM-homeobox; LIM1" /note="domesticus (clone 2.3 kB) lim-1; LIM homeobox protein 1; homeobox protein Lim-1" /codon_start=1 /product="LIM/homeobox protein Lhx1" /protein_id="NP_001384288.1" /db_xref="CGNC:4028" /db_xref="GeneID:396381" /translation="
MVHCAGCKRPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGKLYCKNDFFRCFGTKCAGCAQGISPSDLVRRARSKVFHLNCFTCMMCNKQLSTGEELYIIDENKFVCKEDYLNNSNTAKENSLHSATTGSDPSLSPDSQDPSQDDAKDSESANVSDKETGSNENDDQNLGAKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALGARRHAFFRSPRRMRPLVDRLEPGELLPNGPFSFYGDYQSEYYGPGGNYEFFPQGPPSSQAQTPVELPFGAAGGPPGTPLGALEHPLPGHHPPGEAQRFPDMLAHPAGDSPSPEPTLPGSLHSMSAEVFGPSPPFSSISVNGGANYGNHLSHPPEMNEAAVW"
misc_feature 588..743
/gene="LHX1"
/gene_synonym="LIM-1; LIM-homeobox; LIM1"
/note="The first LIM domain of Lhx1 (also known as Lim1)
and Lhx5; Region: LIM1_Lhx1_Lhx5; cd09367"
/db_xref="CDD:188753"
misc_feature order(588..590,597..599,651..653,660..662,669..671,
678..680,729..731,738..740)
/gene="LHX1"
/gene_synonym="LIM-1; LIM-homeobox; LIM1"
/note="Zn binding site [ion binding]; other site"
/db_xref="CDD:188753"
misc_feature 765..932
/gene="LHX1"
/gene_synonym="LIM-1; LIM-homeobox; LIM1"
/note="The second LIM domain of Lhx1 (also known as Lim1)
and Lhx5; Region: LIM2_Lhx1_Lhx5; cd09375"
/db_xref="CDD:188761"
misc_feature order(765..767,774..776,831..833,840..842,849..851,
858..860,918..920,927..929)
/gene="LHX1"
/gene_synonym="LIM-1; LIM-homeobox; LIM1"
/note="Zn binding site [ion binding]; other site"
/db_xref="CDD:188761"
misc_feature 951..1139
/gene="LHX1"
/gene_synonym="LIM-1; LIM-homeobox; LIM1"
/note="propagated from UniProtKB/Swiss-Prot (P53411.1);
Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
misc_feature 1119..1289
/gene="LHX1"
/gene_synonym="LIM-1; LIM-homeobox; LIM1"
/note="Region: Homeodomain; pfam00046"
/db_xref="CDD:459649"
misc_feature 1464..1694
/gene="LHX1"
/gene_synonym="LIM-1; LIM-homeobox; LIM1"
/note="propagated from UniProtKB/Swiss-Prot (P53411.1);
Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
exon 749..975
/gene="LHX1"
/gene_synonym="LIM-1; LIM-homeobox; LIM1"
/inference="alignment:Splign:2.1.0"
exon 976..1253
/gene="LHX1"
/gene_synonym="LIM-1; LIM-homeobox; LIM1"
/inference="alignment:Splign:2.1.0"
exon 1254..1419
/gene="LHX1"
/gene_synonym="LIM-1; LIM-homeobox; LIM1"
/inference="alignment:Splign:2.1.0"
exon 1420..1820
/gene="LHX1"
/gene_synonym="LIM-1; LIM-homeobox; LIM1"
/inference="alignment:Splign:2.1.0"
exon 1821..3204
/gene="LHX1"
/gene_synonym="LIM-1; LIM-homeobox; LIM1"
/inference="alignment:Splign:2.1.0"
ORIGIN
gcacggacggcggccccgctccgcgccgctcgggccatggcaccgcggctgcagcctgcgcccgtctgaccgcgggcggcccgatgccctgcgcccgcgctgtcctcgtcttgtcgtctttttttttgctttttgctttttttgcttttttttcttttccctcctttaatttctgtttgggaaaagcagatgcactttgactcctgactgctctacctcagacctgagaacaaactcgtcacgcttctcggcggttttttgattatcgccggtttcgttttatctgagcgccgatttctgcgccgccgcgcgtcggcctcagccgggccgggcccgggacccgcggccctgggacagcgaccgaccgaaggcttctctccctcccgtcctttttcttctcttccgcttttccaaggcttttttttttttttaatattaatattaacaataacaacatacacacataaaaaaaaaaaaaagcaaacccacgccgctgttgtcgtctttttgtttttatttcgatttttcgcttgccatctgggacgccgataccccactctcagaaataaccaaagacaatggttcactgtgcgggctgcaaaaggccaatcttggaccggttcttgttgaatgtactggacagggcttggcatgtgaagtgtgttcagtgctgtgaatgtaaatgcaatttgacagagaaatgcttttcgcgagaaggcaagctttactgcaaaaacgacttctttcggtgtttcgggaccaagtgtgcgggctgtgcccagggcatctcccccagcgacctggtccgcagggcgcggagcaaagtgttccacttgaactgttttacgtgtatgatgtgcaacaagcagctctccaccggcgaggagctctatatcatagacgaaaacaagttcgtctgcaaagaagattacctaaataacagcaatactgccaaagaaaacagcctgcattcagctaccaccggcagtgaccccagcctgtcccccgactcccaagacccctcccaggacgacgccaaggactcggaaagcgccaacgtgtccgacaaggagacgggcagcaacgagaacgacgaccagaacctgggggccaagcggcgggggccccgcaccaccatcaaagccaaacagctagagactctgaaggccgccttcgcggccacccccaaacccacgcggcacatcagggagcagctggcgcaggagaccggcctcaacatgcgcgtcatccaggtgtggttccagaaccgccgctccaaggagcgccgcatgaagcagctgagcgcgctgggcgcccgccggcacgccttcttccgcagcccgcgcaggatgcggccgctggtggaccgcctggagcccggcgagctgctccccaacgggcccttctccttctacggagattaccagagcgagtactacggccccgggggcaactacgagttcttcccgcaaggcccgccctcctcgcaggcgcagacgccggtggagctgccgttcggggcggcgggcggaccgccgggcacgccgctgggcgcgttggagcacccgctgcccgggcaccacccgcccggagaggcgcagcgcttccccgacatgctggcgcaccccgccggggactcgcccagccccgagcccaccctgcccggctccctgcactccatgtccgcggaagtgttcggccccagtcctccgttctcctcgatatccgtcaacggcggtgctaactacggcaatcacttgtcacacccaccagaaatgaacgaagcggctgtgtggtagctttaagcgaactgggtctaaacaatgtcacctcgggaacgaactgcgcccggcggctccgagcggagcgctgctgcagagcgggacgatcccggtgtgcgtttgtcaccgacacggggacctgcgtgtgccatgacaaaggaactggtgaagctgtacagtaacgcgccgccgcgccgtgggatggcgtgagtgtggttaccccgtcggatgtcaccccgagagccacaatccttaggaactcctcgtttagaaaaaaaaacaaacagtgattgaatggcggaaaggtgaaaggaaagggggaaaagctgcaagaactctgagcgctcccgataaggatggttctggcgttccgcatttgtttgttcatttttctctctcaaagttcaaccacgagaaactctttagcttcagccattgcagcctgctgagcaccaggtgggacaacttttctttctccttttttttttttctcctttgttgttttttttccggttgttgttttcttcttttgtttccctccccaaataacgaatactaaatgttgagccctcggcaccaactcttctaccttcacaatgctacacatacaaaacctcctcatcatagcaaaggtcgccgtcggacctctaaggcgaatgacttgaaaagaaaaaaaaaatacaaaaaaaaaaaaaaccacaaaaaaacaaacgaacaaaaagcattctaccttcacaaagagagcgaagcaaaacgaaaagactctattgaactaaaacagtcaactgtttacgtctaacgttaaattcaggagctcgatgttttactaacaaatcctgttttagaacctcttgttcgaaagcaaaatattttgagcagccaaccaaaatagttccttttcttttctgtagatgtacaaagcgatcgcagggcttgtggttcactgtgctagtttgtcaaaggtgttgtttacagaaggcaaagagaaacccgcgaatcccagaccgttgccaaataaagggaatctatagcacaaatactgtcaggtgctccgcaccagcaacccggagaggcgtttccaaatgtcacaaggttaaaaccagaacagaacgaacatctttgctgatttttagtcctgttgaacattcatggaattgttaatatgacttatatagacccacacaggttttatttttgtgtctttaaaatgaaagtccaaaatatttaaattttatggtcaaatatgcagtcgacagctgctacttttttctttatatattaaatttctcatatgtcttttattgttcgaataaacctaagcttgtgtgacctccagtgcatattagaccattcactgtatgaaagaaaacatgttggataaaaatttgtgcgtttttaataaaattagaaaatgggacgttta
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]