LOCUS       NM_001277282             938 bp    mRNA    linear   VRT 24-SEP-2023
DEFINITION  Gallus gallus homeobox C9 (HOXC9), mRNA.
ACCESSION   NM_001277282 XM_423451
VERSION     NM_001277282.2
KEYWORDS    RefSeq.
SOURCE      Gallus gallus (chicken)
  ORGANISM  Gallus gallus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
            Phasianidae; Phasianinae; Gallus.
REFERENCE   1  (bases 1 to 938)
  AUTHORS   Tang H, Finn RD and Thomas PD.
  TITLE     TreeGrafter: phylogenetic tree-based annotation of proteins with
            Gene Ontology terms and other annotations
  JOURNAL   Bioinformatics 35 (3), 518-520 (2019)
   PUBMED   30032202
REFERENCE   2  (bases 1 to 938)
  AUTHORS   Burge S, Kelly E, Lonsdale D, Mutowo-Muellenet P, McAnulla C,
            Mitchell A, Sangrador-Vegas A, Yong SY, Mulder N and Hunter S.
  TITLE     Manual GO annotation of predictive protein signatures: the InterPro
            approach to GO curation
  JOURNAL   Database (Oxford) 2012, bar068 (2012)
   PUBMED   22301074
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 938)
  AUTHORS   Izpisua-Belmonte JC, Tickle C, Dolle P, Wolpert L and Duboule D.
  TITLE     Expression of the homeobox Hox-4 genes and the specification of
            position in chick wing development
  JOURNAL   Nature 350 (6319), 585-589 (1991)
   PUBMED   1673231
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            JAENSK010000489.1.
            
            On Dec 15, 2021 this sequence version replaced NM_001277282.1.
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on transcript alignments.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BX950823.1, HAEL01007746.1
                                           [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA103992323, SAMEA103992415
                                           [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-580               JAENSK010000489.1  20401-20980         c
            581-938             JAENSK010000489.1  17993-18350         c
FEATURES             Location/Qualifiers
     source          1..938
                     /organism="Gallus gallus"
                     /mol_type="mRNA"
                     /db_xref="taxon:9031"
                     /chromosome="34"
                     /map="34"
     gene            1..938
                     /gene="HOXC9"
                     /note="homeobox C9"
                     /db_xref="CGNC:8844"
                     /db_xref="GeneID:425723"
     exon            1..580
                     /gene="HOXC9"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    7..9
                     /gene="HOXC9"
                     /note="upstream in-frame stop codon"
     CDS             37..825
                     /gene="HOXC9"
                     /note="chox-4.4; homeobox protein Hox-4.4; homeo box C9"
                     /codon_start=1
                     /product="homeobox protein HoxC9"
                     /protein_id="NP_001264211.1"
                     /db_xref="CGNC:8844"
                     /db_xref="GeneID:425723"
                     /translation="

MSASGPISNYYVDSLISHENEELLASRFPTTASHPAAARPSGLVPDCADFPSCSFAPKPAVFTTSWAPVHSQSSVGYHHPYGPQAPVGAEPRYMRTWLEPLAGAVSFPAFAPGAARPYGLKPDAFAGRRAECGPADGRGFADYMYAAPGELRDRAAQTIPSPESEAIASSKHKEEKHELDPNNPVANWIHARSTRKKRCPYTKYQTLELEKEFLFNMYLTRDRRYEVARVLNLTERQVKIWFQNRRMKMKKMNKEKTDKEQP"

     misc_feature    37..579
                     /gene="HOXC9"
                     /note="Hox9 activation region; Region: Hox9_act;
                     pfam04617"
                     /db_xref="CDD:428038"
     misc_feature    616..765
                     /gene="HOXC9"
                     /note="Homeodomain; Region: HOX; smart00389"
                     /db_xref="CDD:197696"
     exon            581..938
                     /gene="HOXC9"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

atacaataatcttatgaatgtaaaagagggggaaccatgtcggcttctggccccataagcaactactatgtagactccttgataagccacgaaaacgaagagctcttggcctccaggttccccaccactgcctcccacccggctgctgccagaccttcaggattagtcccggactgtgccgactttccttcgtgcagtttcgcccccaagccggccgtttttacaacctcctgggctcccgtccattcccagtcgtccgtgggctaccaccacccgtacggcccccaggctcccgtgggggccgagcccaggtacatgcggacttggctcgagcccctcgccggggccgtctcgttcccggccttcgctcccggtgccgcccgcccctacggcctcaaacccgacgcctttgccgggagacgcgcggagtgcggccccgcggacgggcgcggcttcgcggactacatgtacgcggctcccggggagctgagagacagagcagcgcagacaattccttccccggagtccgaagccatcgcttccagcaaacacaaagaagaaaagcacgaattagaccctaacaatcccgtcgcgaattggattcatgcgcgttccacgaggaagaaaagatgtccgtacacaaagtatcagaccctggaactggaaaaagagtttttattcaatatgtacctcacacgggaccggaggtacgaagtagcccgagtcctaaacctcactgaacgccaagtcaaaatctggtttcagaacaggcgaatgaaaatgaagaaaatgaataaagagaaaaccgataaggaacagccatgaaaagtcgtgcgaggagaaacgagggcggaaaaaggaaaaaaaaaagaaaaaagaaaaaaaaaagaggaaaaaaaaaaacccaacaaaaagaaggcaaaaaaaaaaaaaaaaaa

//