2024-04-27 05:47:48, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001194880 663 bp mRNA linear PRI 05-JUL-2020 DEFINITION Macaca mulatta claudin 24 (CLDN24), mRNA. ACCESSION NM_001194880 XM_002804270 VERSION NM_001194880.2 KEYWORDS RefSeq. SOURCE Macaca mulatta (Rhesus monkey) ORGANISM Macaca mulatta Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Cercopithecidae; Cercopithecinae; Macaca. COMMENT INFERRED REFSEQ: This record is predicted by genome sequence analysis and is not yet supported by experimental evidence. The reference sequence was derived from QNVO02000369.1. On Jun 30, 2017 this sequence version replaced NM_001194880.1. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-663 QNVO02000369.1 23346220-23346882 c FEATURES Location/Qualifiers source 1..663 /organism="Macaca mulatta" /mol_type="mRNA" /db_xref="taxon:9544" /chromosome="5" /map="5" gene 1..663 /gene="CLDN24" /note="claudin 24" /db_xref="GeneID:100423881" /db_xref="VGNC:VGNC:71381" CDS 1..663 /gene="CLDN24" /codon_start=1 /product="putative claudin-24" /protein_id="NP_001181809.1" /db_xref="GeneID:100423881" /db_xref="VGNC:VGNC:71381" /translation="
MALIFRIVMQSVGLLLSFLGWILSIITTYLPHWKNLNLDLNEMENWTMGLWQTCVTQEEVGMQCKDFDSFLALPAELRVSRILMFLSNGLGFLGLLVSGFGLDCLRIGEGQRDLKRRLLILGGVLSWASGITALVPVSWVAHKTVQEFWDENVPDFVPRWEFGEALFLGWFAGLSLLLGGCLLNCAACSSHALLASGHYAVAQIQTQCSYLEDGTADPQV"
misc_feature 37..516 /gene="CLDN24" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:451326" exon 1..663 /gene="CLDN24" /inference="alignment:Splign:2.1.0" ORIGIN
atggctttaatctttagaatagtgatgcaatctgttgggcttttactatctttcctgggatggattttatccattattacaacttatttgccacactggaagaacctcaacctggacttaaatgaaatggaaaactggaccatgggactctggcaaacctgcgtcacccaagaggaagtgggaatgcaatgcaaggactttgactccttcctggctttgcctgctgaactcagggtctccaggatcttaatgtttctatcaaacgggctgggatttctgggcctgctggtctctgggtttggcctggactgtttgagaattggagagggtcagagagatctcaagaggcgactgctgatcctgggaggagttctgtcctgggcctcgggaatcacagccctggttcctgtctcttgggttgcccacaagacggttcaggagttctgggatgagaacgtcccagactttgtccccaggtgggagtttggggaggccctctttctgggctggtttgctggactttctcttctactgggagggtgtctgctcaactgtgcagcctgttccagccatgctctcctagcttcgggccactatgcagtggcgcaaatacaaactcagtgttcctacctggaagacgggacggcagatcctcaagtgtaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]