GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2020-03-31 05:36:01, GGRNA.v2 : RefSeq release 99 (Mar, 2020)

LOCUS       NM_001194860            2310 bp    mRNA    linear   PRI 12-DEC-2019
DEFINITION  Macaca mulatta claudin 12 (CLDN12), mRNA.
ACCESSION   NM_001194860 XM_002803388
VERSION     NM_001194860.2
KEYWORDS    RefSeq.
SOURCE      Macaca mulatta (Rhesus monkey)
  ORGANISM  Macaca mulatta
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
REFERENCE   1  (bases 1 to 2310)
  AUTHORS   Zimin AV, Cornish AS, Maudhoo MD, Gibbs RM, Zhang X, Pandey S,
            Meehan DT, Wipfler K, Bosinger SE, Johnson ZP, Tharp GK, Marcais G,
            Roberts M, Ferguson B, Fox HS, Treangen T, Salzberg SL, Yorke JA
            and Norgren RB Jr.
  TITLE     A new rhesus macaque assembly and annotation for next-generation
            sequencing analyses
  JOURNAL   Biol. Direct 9 (1), 20 (2014)
   PUBMED   25319552
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 2310)
  AUTHORS   Yan G, Zhang G, Fang X, Zhang Y, Li C, Ling F, Cooper DN, Li Q, Li
            Y, van Gool AJ, Du H, Chen J, Chen R, Zhang P, Huang Z, Thompson
            JR, Meng Y, Bai Y, Wang J, Zhuo M, Wang T, Huang Y, Wei L, Li J,
            Wang Z, Hu H, Yang P, Le L, Stenson PD, Li B, Liu X, Ball EV, An N,
            Huang Q, Zhang Y, Fan W, Zhang X, Li Y, Wang W, Katze MG, Su B,
            Nielsen R, Yang H, Wang J, Wang X and Wang J.
  TITLE     Genome sequencing and comparison of two nonhuman primate animal
            models, the cynomolgus and Chinese rhesus macaques
  JOURNAL   Nat. Biotechnol. 29 (11), 1019-1023 (2011)
   PUBMED   22002653
  REMARK    Publication Status: Online-Only
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from
            QNVO02000313.1.
            On Dec 12, 2019 this sequence version replaced NM_001194860.1.
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.
            
            ##Evidence-Data-START##
            CDS exon combination :: JU496000.1 [ECO:0000331]
            RNAseq introns       :: single sample supports all introns
                                    SAMEA4688316, SAMEA4688317 [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-116               QNVO02000313.1     30925708-30925823
            117-206             QNVO02000313.1     30927682-30927771
            207-2310            QNVO02000313.1     30935644-30937747
FEATURES             Location/Qualifiers
     source          1..2310
                     /organism="Macaca mulatta"
                     /mol_type="mRNA"
                     /db_xref="taxon:9544"
                     /chromosome="3"
                     /map="3"
     gene            1..2310
                     /gene="CLDN12"
                     /gene_synonym="claudin-12"
                     /note="claudin 12"
                     /db_xref="GeneID:704058"
                     /db_xref="VGNC:VGNC:71244"
     exon            1..116
                     /gene="CLDN12"
                     /gene_synonym="claudin-12"
                     /inference="alignment:Splign:2.1.0"
     exon            117..206
                     /gene="CLDN12"
                     /gene_synonym="claudin-12"
                     /inference="alignment:Splign:2.1.0"
     exon            207..2310
                     /gene="CLDN12"
                     /gene_synonym="claudin-12"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    213..215
                     /gene="CLDN12"
                     /gene_synonym="claudin-12"
                     /note="upstream in-frame stop codon"
     CDS             240..974
                     /gene="CLDN12"
                     /gene_synonym="claudin-12"
                     /codon_start=1
                     /product="claudin-12"
                     /protein_id="NP_001181789.1"
                     /db_xref="GeneID:704058"
                     /db_xref="VGNC:VGNC:71244"
                     /translation="
MGCRDVHAATVLSFLCGIASVAGLFAGTLLPNWRKLRLITFNRNEKNLTVYTGLWVKCARYDGSSDCLMYDTTWYSSVDQLDLRVLQFALPLSMLIAMGALLLCLIGMCNTAFRSSVPNIKLAKCLVNSAGCHLVAGLLFFLAGTVSLSPSIWVIFYNIHLNKKFEPVFSFDYAVYVTIASAGGLFMTSLILFIWYCTCKSLPSPFWQPLYSHPPSMHTYSQPYSARSRLSAIEIDIPVVSHTT"
ORIGIN      
gttccgatttctgggtcttttgcataagtaactgaggattttatgtaaaatagctaaatccaggggaatcgggagcattggaaaacgctgaccacatctgtggatgtgaaaattgagctcagattattgctactgtgtattcagatctgcatgtttatcttctaagctgaataaagttgttttggaactgtcgggtacctcaaaggtctgactgacagcactccacaagcttgcctgccatgggctgtcgggatgtccacgcagccacagtcctttccttcctatgtggaatcgcctcagtagcaggcctctttgcagggactctgcttcccaactggagaaaattacgattgatcacattcaacagaaacgagaagaacctgactgtttacacaggcctgtgggtgaaatgtgcccggtatgacgggagcagtgactgcctgatgtacgacactacttggtactcatcagttgaccagctggacctgcgtgtcctccagtttgccctacccctcagcatgttgatcgccatgggtgccctgctgctctgcctgattggaatgtgcaacactgccttcaggtcctcggtgcccaacatcaaactggccaagtgtctggtcaatagtgcaggttgccacctggtggctgggctgctatttttcctggcaggtactgtgagcctctccccatctatctgggtcatcttttataacatccatctgaacaagaagtttgagccagtcttttcatttgactatgcagtgtatgtcactattgctagtgctgggggcctgtttatgacttcccttatactgtttatttggtattgtacatgcaaatctttgccttctcctttctggcaaccactgtactcccatccacccagtatgcatacttactcacagccctattcagcacgctctcgcctctctgccattgaaattgacattccagtagtttcacacaccacttaatggggaaatagttaattgttaaagaaaacttcttgtagcctcacattccccttgtgcaaggagctcttttggacctatatacattttcctttgtttttgaccaatcaatgaagccaaatttgtatgtcctggtagaatgaagtgctgctagtttttatgagaagtacattatattaaatgtgaatttttttattttgcttcttatactggaaggaattttagccttcatattgatatctaattaattatttaagtggaagaggcctgcatcacaattgaggtgatttagagcaacatgttaaagaatcatggttagcagaagctgttgcatacaatcttcatgaatatttcagtgtgtatttttctttttctataatacctttaactgcaaagaaaaggcagtttcaaatataagaaatttatttcaggtaagggtaatattttaatagtagtcaataatctagcttaaggctgtaactcttctctctcggggctaattgtatgaataggtgtcagtatattgaagattactttcttttgtgactttcttctacctcatgccagtgtttaaaagtaaaatgtattttaaatgatgttagactaagaccaccattctaaatatcacctacttatgaataacatataatactttttaacattaatgattccataaattgtgttattgggattagaatgtgctttatgacaggttagtgtttcctctgaggcagaaaacccttttttggagatatcatccatcaagcagtactcatgcccgtatacaatctcttagtggctaagagaagtaaataaaagggccataatcatttgctctctttcagacataatttagtaggggacaagaagtctgttcttcagtgactacaatagagatttactctgctgactgccttttgagttatgggtgatgtaaggtatggctttaccataaccttgattcattcacccttgattcatttcccacccctgtcactgattatttccttgagcatatatctctgcctaacactttagtaggtgctatagaggatatatgaaaagtatgagatctggtcccatccagtaagacattttaatagagaagatcaaaatgttacctgatggttggggaatagtctgacttcattggcagttggccttaacttcttaatcattgatccaggaatatttcaaccagaggcacaactttctggcagacagacaaattgtacaacaccaacaatatcctggaccttgaaattctgtttacttcagtccattgtatccttaaggcacctgtgctagcctagattttgtaatagcattgatttatgag
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]