LOCUS       NM_001191995             869 bp    mRNA    linear   ROD 21-MAR-2023
DEFINITION  Rattus norvegicus brain specific homeobox (Bsx), mRNA.
ACCESSION   NM_001191995 XM_576393
VERSION     NM_001191995.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 869)
  AUTHORS   Carstensen MB, Hertz H, Bering T, Moller M, Rohde K, Klein DC, Coon
            SL and Rath MF.
  TITLE     Circadian regulation and molecular role of the Bsx homeobox gene in
            the adult pineal gland
  JOURNAL   J Pineal Res 68 (2), e12629 (2020)
   PUBMED   31808568
  REMARK    GeneRIF: Circadian regulation and molecular role of the Bsx
            homeobox gene in the adult pineal gland.
REFERENCE   2  (bases 1 to 869)
  AUTHORS   Lage R, Vazquez MJ, Varela L, Saha AK, Vidal-Puig A, Nogueiras R,
            Dieguez C and Lopez M.
  TITLE     Ghrelin effects on neuropeptides in the rat hypothalamus depend on
            fatty acid metabolism actions on BSX but not on gender
  JOURNAL   FASEB J 24 (8), 2670-2679 (2010)
   PUBMED   20335227
  REMARK    GeneRIF: Ghrelin-induced changes in the AMPK-CPT1 pathway are
            associated with increased levels of AgRP and NPY mRNA expression
            through modulation of BSX, pCREB, and FoxO1 in a gender-independent
            manner.
REFERENCE   3  (bases 1 to 869)
  AUTHORS   McArthur T and Ohtoshi A.
  TITLE     A brain-specific homeobox gene, Bsx, is essential for proper
            postnatal growth and nursing
  JOURNAL   Mol Cell Biol 27 (14), 5120-5127 (2007)
   PUBMED   17485440
REFERENCE   4  (bases 1 to 869)
  AUTHORS   Sakkou M, Wiedmer P, Anlag K, Hamm A, Seuntjens E, Ettwiller L,
            Tschop MH and Treier M.
  TITLE     A role for brain-specific homeobox factor Bsx in the control of
            hyperphagia and locomotory behavior
  JOURNAL   Cell Metab 5 (6), 450-463 (2007)
   PUBMED   17550780
REFERENCE   5  (bases 1 to 869)
  AUTHORS   Chu HY and Ohtoshi A.
  TITLE     Cloning and functional analysis of hypothalamic homeobox gene Bsx1a
            and its isoform, Bsx1b
  JOURNAL   Mol Cell Biol 27 (10), 3743-3749 (2007)
   PUBMED   17353277
COMMENT     INFERRED REFSEQ: This record is predicted by genome sequence
            analysis and is not yet supported by experimental evidence. The
            reference sequence was derived from JACYVU010000198.1.
            
            On Jul 17, 2010 this sequence version replaced XM_576393.2.
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-307               JACYVU010000198.1  3067416-3067722
            308-504             JACYVU010000198.1  3069608-3069804
            505-869             JACYVU010000198.1  3070808-3071172
FEATURES             Location/Qualifiers
     source          1..869
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN"
                     /db_xref="taxon:10116"
                     /chromosome="8"
                     /map="8q22"
     gene            1..869
                     /gene="Bsx"
                     /gene_synonym="RGD1565120"
                     /note="brain specific homeobox"
                     /db_xref="GeneID:500982"
                     /db_xref="RGD:1565120"
     exon            1..307
                     /gene="Bsx"
                     /gene_synonym="RGD1565120"
                     /inference="alignment:Splign:2.1.0"
     CDS             46..744
                     /gene="Bsx"
                     /gene_synonym="RGD1565120"
                     /codon_start=1
                     /product="brain-specific homeobox protein homolog"
                     /protein_id="NP_001178924.1"
                     /db_xref="GeneID:500982"
                     /db_xref="RGD:1565120"
                     /translation="

MNLNFTSPLHPASSQRPTSFFIEDILLHKPKPLREVAPDHFASSLASRVPLLDYGYPLMPTPTLLTPHTHHPLHKGEHHHPYFLATSGMPVPALFPHPQHAELPGKHCRRRKARTVFSDSQLSGLEKRFEIQRYLSTPERVELATALSLSETQVKTWFQNRRMKHKKQLRKSQDEPKAADGPESPEGSPRAPEGAPADARLSLPAGAFVLTEPEDEVDIGDEGELSSGPHVL"

     misc_feature    order(376..390,394..396,445..447,463..465,502..504,
                     508..513,520..525,529..537,541..546)
                     /gene="Bsx"
                     /gene_synonym="RGD1565120"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(382..384,391..393,511..513,520..525,532..534)
                     /gene="Bsx"
                     /gene_synonym="RGD1565120"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    385..543
                     /gene="Bsx"
                     /gene_synonym="RGD1565120"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
     exon            308..504
                     /gene="Bsx"
                     /gene_synonym="RGD1565120"
                     /inference="alignment:Splign:2.1.0"
     exon            505..869
                     /gene="Bsx"
                     /gene_synonym="RGD1565120"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

ctgcactttgtccgggccctcgccccgtgccaggcgctctgcaagatgaatctcaacttcacttcccctctccatccagcatcttctcagaggcccacgtcgtttttcatcgaggacattctgctacacaagcccaagccgttgagggaagtggcccctgaccactttgccagctctctggcctctagggtgcctttgctagactatggctacccccttatgcccacacccaccctcctcacccctcacactcatcatcctctgcataagggggagcatcatcacccttatttcctggccacctcagggatgccggtcccggctctgttcccgcacccgcagcatgcagagctacccgggaagcactgccgccgccgcaaagctcgcacggtgttttctgactcgcagctctccggcctggagaaaaggttcgaaatccagcgctacctgtcgacaccagagcgtgtggagctggccactgctctcagcctctctgagactcaggtgaaaacgtggttccagaaccggcggatgaagcataaaaaacagctgaggaaaagtcaagacgaacccaaagccgcagacgggcctgagagcccagagggcagccctcgtgctcccgagggcgcgcccgccgacgctcggctgagtttgccggccggtgccttcgtgcttacagagccggaggacgaggtggacattggggacgaaggcgagctcagctcagggccgcacgtgctctgagtggccaggctgggaagggagacccgggcgaggaggctgtggggccagacccggttctttccgggcgagaagactcgcggagactctagactgttcctgcggcctggactggaagaaagaaaggc

//