GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2020-04-07 23:22:21, GGRNA.v2 : RefSeq release 99 (Mar, 2020)

LOCUS       NM_001185023            1944 bp    mRNA    linear   PRI 09-FEB-2020
DEFINITION  Homo sapiens claudin 7 (CLDN7), transcript variant 3, mRNA.
ACCESSION   NM_001185023
VERSION     NM_001185023.1
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1944)
  AUTHORS   Kyuno D, Zhao K, Schnolzer M, Provaznik J, Hackert T and Zoller M.
  TITLE     Claudin7-dependent exosome-promoted reprogramming of
            nonmetastasizing tumor cells
  JOURNAL   Int. J. Cancer 145 (8), 2182-2200 (2019)
   PUBMED   30945750
  REMARK    GeneRIF: Results how that cancer-initiating cell (CIC) -tumor
            exosomes (TEX) rescue Claudin7 (cld7)-knockdown (kd) (cld7kd) tumor
            progression.
REFERENCE   2  (bases 1 to 1944)
  AUTHORS   Zhou S, Piao X, Wang C, Wang R and Song Z.
  TITLE     Identification of claudin1, 3, 7 and 8 as prognostic markers in
            human laryngeal carcinoma
  JOURNAL   Mol Med Rep 20 (1), 393-400 (2019)
   PUBMED   31115553
  REMARK    GeneRIF: the findings of the present study demonstrated that the
            expression levels of CLDN1, 3, 7 and 8 varied between laryngeal
            squamous carcinoma tissues and nonneoplastic tissues
REFERENCE   3  (bases 1 to 1944)
  AUTHORS   Wang K, Li T, Xu C, Ding Y, Li W and Ding L.
  TITLE     Claudin-7 downregulation induces metastasis and invasion in
            colorectal cancer via the promotion of epithelial-mesenchymal
            transition
  JOURNAL   Biochem. Biophys. Res. Commun. 508 (3), 797-804 (2019)
   PUBMED   30528239
  REMARK    GeneRIF: Decreasing expression of Claudin-7 may promote the
            invasion and metastasis of colorectal cancer by regulating
            epithelial-mesenchymal transition.
REFERENCE   4  (bases 1 to 1944)
  AUTHORS   Okui N, Kamata Y, Sagawa Y, Kuhara A, Hayashi K, Uwagawa T, Homma S
            and Yanaga K.
  TITLE     Claudin 7 as a possible novel molecular target for the treatment of
            pancreatic cancer
  JOURNAL   Pancreatology 19 (1), 88-96 (2019)
   PUBMED   30416041
  REMARK    GeneRIF: CLDN7 may be expressed in the rapidly proliferating and
            dominant cell population in human pancreatic cancer tissues.
REFERENCE   5  (bases 1 to 1944)
  AUTHORS   Li Y, Gong Y, Ning X, Peng D, Liu L, He S, Gong K, Zhang C, Li X
            and Zhou L.
  TITLE     Downregulation of CLDN7 due to promoter hypermethylation is
            associated with human clear cell renal cell carcinoma progression
            and poor prognosis
  JOURNAL   J. Exp. Clin. Cancer Res. 37 (1), 276 (2018)
   PUBMED   30428910
  REMARK    GeneRIF: Authors have demonstrated a previously undescribed role of
            CLDN7 as a ccRCC suppressor and suggest that loss of CLDN7
            potentiates EMT and tumor progression.
            Publication Status: Online-Only
REFERENCE   6  (bases 1 to 1944)
  AUTHORS   Heiskala M, Peterson PA and Yang Y.
  TITLE     The roles of claudin superfamily proteins in paracellular transport
  JOURNAL   Traffic 2 (2), 93-98 (2001)
   PUBMED   11247307
  REMARK    Review article
REFERENCE   7  (bases 1 to 1944)
  AUTHORS   Kniesel U and Wolburg H.
  TITLE     Tight junctions of the blood-brain barrier
  JOURNAL   Cell. Mol. Neurobiol. 20 (1), 57-76 (2000)
   PUBMED   10690502
  REMARK    Review article
REFERENCE   8  (bases 1 to 1944)
  AUTHORS   Itoh M, Furuse M, Morita K, Kubota K, Saitou M and Tsukita S.
  TITLE     Direct binding of three tight junction-associated MAGUKs, ZO-1,
            ZO-2, and ZO-3, with the COOH termini of claudins
  JOURNAL   J. Cell Biol. 147 (6), 1351-1363 (1999)
   PUBMED   10601346
REFERENCE   9  (bases 1 to 1944)
  AUTHORS   Morita K, Furuse M, Fujimoto K and Tsukita S.
  TITLE     Claudin multigene family encoding four-transmembrane domain protein
            components of tight junction strands
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 96 (2), 511-516 (1999)
   PUBMED   9892664
REFERENCE   10 (bases 1 to 1944)
  AUTHORS   Peacock RE, Keen TJ and Inglehearn CF.
  TITLE     Analysis of a human gene homologous to rat ventral prostate.1
            protein
  JOURNAL   Genomics 46 (3), 443-449 (1997)
   PUBMED   9441748
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from CV575841.1, AC003688.1 and
            BC071844.1.
            
            Summary: This gene encodes a member of the claudin family. Claudins
            are integral membrane proteins and components of tight junction
            strands. Tight junction strands serve as a physical barrier to
            prevent solutes and water from passing freely through the
            paracellular space between epithelial or endothelial cell sheets,
            and also play critical roles in maintaining cell polarity and
            signal transductions. Differential expression of this gene has been
            observed in different types of malignancies, including breast
            cancer, ovarian cancer, hepatocellular carcinomas, urinary tumors,
            prostate cancer, lung cancer, head and neck cancers, thyroid
            carcinomas, etc.. Alternatively spliced transcript variants
            encoding different isoforms have been found.[provided by RefSeq,
            May 2010].
            
            Transcript Variant: This variant (3) lacks an exon in the 3' CDS,
            as compared to variant 1. The resulting isoform (2) has a shorter
            and distinct C-terminus, as compared to isoform 1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-468               CV575841.1         1-468
            469-1125            AC003688.1         64217-64873         c
            1126-1290           AC003688.1         63217-63381         c
            1291-1917           AC003688.1         62306-62932         c
            1918-1944           BC071844.1         1341-1367
FEATURES             Location/Qualifiers
     source          1..1944
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="17"
                     /map="17p13.1"
     gene            1..1944
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /note="claudin 7"
                     /db_xref="GeneID:1366"
                     /db_xref="HGNC:HGNC:2049"
                     /db_xref="MIM:609131"
     exon            1..1125
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /inference="alignment:Splign:2.1.0"
     variation       1..2
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="gg"
                     /db_xref="dbSNP:1487791537"
     variation       1..2
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="gg"
                     /replace="ggg"
                     /db_xref="dbSNP:1187413912"
     variation       3..10
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="aaaaaaaa"
                     /replace="aaaaaaaaa"
                     /replace="aaaaaaaaaa"
                     /db_xref="dbSNP:137931761"
     variation       3
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:192262608"
     variation       4
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:969684358"
     variation       21
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1388915149"
     variation       26
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1456320794"
     variation       29
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:775894437"
     variation       30
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1381019285"
     variation       38
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:780571096"
     variation       41
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:998657472"
     variation       42
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:901933810"
     variation       46
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:371045446"
     variation       63
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:758838454"
     variation       67..69
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="cc"
                     /replace="ccc"
                     /db_xref="dbSNP:1328766972"
     variation       67
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1320456242"
     variation       72
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:962183181"
     variation       73
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:556193383"
     variation       76
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1483766998"
     variation       80
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1200440582"
     variation       86
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1015007659"
     variation       88
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:910536331"
     variation       90
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:796914082"
     variation       97
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1183721960"
     variation       99
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1411985760"
     variation       100
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:142756120"
     variation       103
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1156464787"
     variation       104
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:545899911"
     variation       105
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1029014350"
     variation       107
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1302261442"
     variation       112
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:753298999"
     variation       116
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:576961998"
     variation       124
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1359624888"
     variation       133
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1226840914"
     variation       140
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:972644994"
     variation       143
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:763645527"
     variation       145
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142458277"
     variation       146
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1313217087"
     variation       150
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1232985401"
     variation       154
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:554337874"
     variation       164
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1040304908"
     variation       167
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1206438501"
     variation       185
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1251957377"
     variation       187
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:928402219"
     variation       188
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:755788418"
     variation       191
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1426823473"
     variation       193
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1433340210"
     variation       194
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:186079993"
     variation       197
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1054254127"
     variation       204
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:568720596"
     variation       205
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1308532071"
     variation       220
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1370086514"
     variation       222
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:969720823"
     variation       223
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:759423564"
     variation       225
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1183046681"
     variation       230
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1483306941"
     variation       235
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1368580080"
     variation       239
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:554977817"
     variation       242
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1208662136"
     variation       244
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:535411637"
     variation       247
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1044091417"
     variation       248
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:569680400"
     variation       251
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1274532393"
     variation       259
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1340927814"
     variation       263
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147711018"
     variation       264
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:918207999"
     variation       268
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1218455534"
     variation       269
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:867922127"
     variation       270
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:533058576"
     variation       273
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1315137211"
     variation       276
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:570481954"
     variation       286
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1040504448"
     variation       288
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1007634979"
     variation       293
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1408080023"
     variation       296
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:889156164"
     variation       297
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1350494229"
     variation       299..301
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="gg"
                     /replace="ggg"
                     /db_xref="dbSNP:1378538015"
     variation       311
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1457623708"
     variation       315
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1301229491"
     variation       317
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:908065045"
     variation       318
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:985342039"
     variation       327
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1297237060"
     variation       338
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1331759974"
     variation       339
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1464926262"
     variation       340
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:180794153"
     variation       344
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:930621185"
     variation       349
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1220439218"
     variation       352
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1423826206"
     variation       356
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1466143248"
     variation       360
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:919511662"
     variation       366
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1036588289"
     variation       369
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1029477039"
     variation       371
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1412433554"
     variation       374
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:996223735"
     variation       382
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1442058359"
     variation       390
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1404825325"
     variation       391
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:957637414"
     variation       392
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1391113233"
     variation       396
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1457912216"
     variation       401
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:547557100"
     variation       405
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:527512453"
     variation       406..431
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="cccg"
                     /replace="cccggggcgcgcgggccgcgcccccg"
                     /db_xref="dbSNP:890779433"
     variation       408
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1343758446"
     variation       411
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:948467739"
     variation       414
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:190323961"
     variation       416
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1379341242"
     variation       420
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1010167676"
     variation       426
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1267386586"
     variation       428
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:891689951"
     variation       433
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1032023832"
     variation       434
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:556724330"
     variation       435
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:977316558"
     variation       441
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1237978828"
     variation       442
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:965896109"
     variation       445
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="aa"
                     /db_xref="dbSNP:1242463952"
     variation       456
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:541762847"
     variation       466
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1158663233"
     variation       472
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1309920638"
     variation       475
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:762972726"
     variation       481
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1000420016"
     variation       488
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1335534256"
     variation       489
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1359104349"
     variation       494
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:905641068"
     variation       504
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1310568522"
     variation       511
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1394081659"
     variation       512
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1295133566"
     variation       517
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:889202651"
     variation       524
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1044531057"
     variation       531
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1027706191"
     variation       536
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1278997029"
     variation       538
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1441792056"
     variation       540
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1208586581"
     variation       541
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:949790613"
     variation       542
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1458095622"
     variation       549
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1254118451"
     variation       552
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:773234630"
     variation       557
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:376553754"
     variation       565
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:995260452"
     variation       566
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1181800749"
     variation       567
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1362276395"
     variation       581
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1479093250"
     variation       583
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:916921495"
     variation       590
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:865833864"
     variation       597
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1036626442"
     variation       598
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1433435698"
     variation       606
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:940964473"
     variation       607
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1567596601"
     variation       610
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:908114304"
     variation       619
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1371923766"
     variation       621
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:897803569"
     variation       628
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1333633689"
     variation       629
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1438106745"
     variation       637
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1275249313"
     variation       643
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1036597111"
     variation       645
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1232050496"
     variation       650
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1421012498"
     variation       652
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:562531705"
     variation       657
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1204534727"
     variation       658
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:545836584"
     variation       661
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:906746495"
     variation       664
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1199803833"
     variation       666
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1246532586"
     variation       683
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1045209455"
     variation       684
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1191119142"
     variation       689
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:985003077"
     variation       694
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1269908688"
     variation       696
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:145562713"
     variation       699
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1429607739"
     variation       703
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1488265614"
     variation       704
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1166830837"
     variation       707
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1393643322"
     variation       720
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:915656521"
     variation       730
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1263922341"
     variation       733
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1370049768"
     variation       740
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1438432933"
     variation       747..748
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="aa"
                     /db_xref="dbSNP:554859335"
     variation       762
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:935687985"
     variation       769
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:922082071"
     variation       773
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1354505613"
     variation       778
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1249727512"
     variation       779
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1358522429"
     variation       785..787
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="t"
                     /replace="ttt"
                     /db_xref="dbSNP:1286573700"
     variation       796
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:924286331"
     variation       802..805
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="ctcc"
                     /db_xref="dbSNP:977368556"
     variation       803
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1333980478"
     variation       808
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:975237626"
     variation       813
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:764443909"
     variation       814
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376253030"
     variation       816..820
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="tt"
                     /replace="ttctt"
                     /db_xref="dbSNP:1248981146"
     variation       818
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1467469613"
     variation       819
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1356023821"
     variation       824
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1449425277"
     variation       825
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1168830543"
     variation       827
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:966086571"
     variation       829
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:775710738"
     variation       832
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1430082081"
     variation       836
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:759574089"
     variation       839
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:185564333"
     variation       840
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:770858925"
     variation       842
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200696657"
     variation       845
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1481834990"
     variation       848
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1459497098"
     variation       854
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1322329322"
     variation       855
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:748120999"
     variation       856
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1196370484"
     variation       857
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1316917980"
     misc_feature    858..860
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /note="upstream in-frame stop codon"
     variation       860
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1381619953"
     variation       861
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1263285416"
     variation       862
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:781238084"
     variation       864
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:768594838"
     variation       866..869
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="ccc"
                     /replace="cccc"
                     /db_xref="dbSNP:56219105"
     variation       866
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1300547900"
     variation       868
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1293325573"
     variation       869
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:141537294"
     variation       871
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:199606116"
     variation       873
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1433492809"
     variation       874
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1375278270"
     variation       876
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1328969237"
     variation       877
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:746781493"
     variation       878
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:779894575"
     variation       879
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1033330581"
     variation       883
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1464633929"
     variation       886
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1377089790"
     variation       891
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:758069878"
     variation       893
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:778866641"
     variation       896
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1421328771"
     variation       897
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1347539363"
     variation       899
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1236803997"
     variation       900
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:749963386"
     CDS             903..1340
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /note="isoform 2 precursor is encoded by transcript
                     variant 3; clostridium perfringens enterotoxin
                     receptor-like 2; epididymis secretory sperm binding
                     protein"
                     /codon_start=1
                     /product="claudin-7 isoform 2 precursor"
                     /protein_id="NP_001171952.1"
                     /db_xref="CCDS:CCDS54081.1"
                     /db_xref="GeneID:1366"
                     /db_xref="HGNC:HGNC:2049"
                     /db_xref="MIM:609131"
                     /translation="
MANSGLQLLGFSMALLGWVGLVACTAIPQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTGMMSCKMYDSVLALSAALQATRALMVVSLVLGFLAMFVATMGMKCTRCGGDDKVKKARIAMGGGIIFIVAGMSLALPSLLAGQGLP"
     sig_peptide     903..974
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /inference="COORDINATES: ab initio prediction:SignalP:4.0"
     misc_feature    912..>1298
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:304458"
     misc_feature    924..986
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (O95471.4);
                     transmembrane region"
     misc_feature    1146..1208
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (O95471.4);
                     transmembrane region"
     variation       906
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1567596437"
     variation       908
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:778496052"
     variation       910
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:374655416"
     variation       913
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1201779323"
     variation       914
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:764533562"
     variation       917
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:761074982"
     variation       918
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1239689928"
     variation       919
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1203949961"
     variation       920
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1355767769"
     variation       924
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1258863306"
     variation       927
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:753027850"
     variation       928
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1445726887"
     variation       929
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1383199505"
     variation       940
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1014871951"
     variation       944
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:767698459"
     variation       948
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:759789750"
     variation       950
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1003791768"
     variation       959..961
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="gg"
                     /replace="ggg"
                     /db_xref="dbSNP:771964031"
     variation       960
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1160891664"
     variation       963
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:35178249"
     variation       968
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1412501955"
     variation       969
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1455867340"
     variation       971
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:774371364"
     variation       977
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:771074161"
     variation       979
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:11655844"
     variation       981
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1287114940"
     variation       983
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1411814278"
     variation       985
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:763080763"
     variation       986
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1013971519"
     variation       992
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:374957746"
     variation       995
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:768686747"
     variation       997
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1254939116"
     variation       1003
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1205196104"
     variation       1009
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:574955449"
     variation       1010
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1283830501"
     variation       1015..1020
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="aca"
                     /replace="acaaca"
                     /db_xref="dbSNP:778664885"
     variation       1016
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1239291208"
     variation       1018
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:771710986"
     variation       1019
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:745726375"
     variation       1021
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:745535338"
     variation       1028
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:756811754"
     variation       1035
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1340093161"
     variation       1036
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1045259550"
     variation       1037
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:948237100"
     variation       1040
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1567596313"
     variation       1042
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1383974416"
     variation       1046
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:893954266"
     variation       1047
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:748773256"
     variation       1049
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1346355674"
     variation       1065
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1298150934"
     variation       1066
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199539972"
     variation       1070
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:144545597"
     variation       1072
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:753117808"
     variation       1073
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200335308"
     variation       1078
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1367511929"
     variation       1082
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:569618349"
     variation       1084
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:556173986"
     variation       1085
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1186828683"
     variation       1086
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:766489545"
     variation       1088
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:374173666"
     variation       1090
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376371298"
     variation       1091
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1466522162"
     variation       1108
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:773424587"
     variation       1113
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:373360250"
     variation       1119
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:760706346"
     variation       1121
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:775220631"
     variation       1122
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:944320634"
     variation       1123..1124
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:771152939"
     variation       1125
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1555533558"
     exon            1126..1290
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /inference="alignment:Splign:2.1.0"
     variation       1127
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1276524007"
     variation       1130
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1019664423"
     variation       1137
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1328383401"
     variation       1141
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1352028474"
     variation       1143
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:781744000"
     variation       1144
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:769041772"
     variation       1150
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1376564183"
     variation       1153
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:986873517"
     variation       1154
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1448217463"
     variation       1158
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:954296922"
     variation       1159
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1289972707"
     variation       1160
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1567595878"
     variation       1163..1182
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="cctgg"
                     /replace="cctggtgctgggcttcctgg"
                     /db_xref="dbSNP:929702652"
     variation       1163
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:560743926"
     variation       1164
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149308129"
     variation       1166
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:568192125"
     variation       1167
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:758773722"
     variation       1170
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:750701862"
     variation       1173
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1379386241"
     variation       1174
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1184458638"
     variation       1175
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1484353254"
     variation       1178
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:779224586"
     variation       1181
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1209469876"
     variation       1182
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:547957587"
     variation       1185
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:757459277"
     variation       1186
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:908450344"
     variation       1191
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1305394346"
     variation       1197
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:758959441"
     variation       1199
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:144832882"
     variation       1201
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373478236"
     variation       1202
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:762687113"
     variation       1207
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:772901497"
     variation       1213
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1261083159"
     variation       1216
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1476988508"
     variation       1217
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:769406740"
     variation       1219
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:761455420"
     variation       1221
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1446617432"
     variation       1224
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:142682069"
     variation       1225
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:867054456"
     variation       1227
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1417726116"
     variation       1228
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:369146758"
     variation       1229
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:747479920"
     variation       1230
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1425823001"
     variation       1231
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1430383436"
     variation       1233
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:568777982"
     variation       1238
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:746209260"
     variation       1245
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1478207610"
     variation       1246
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1265340892"
     variation       1248
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1215103064"
     variation       1249
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:779314588"
     variation       1252
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:757414858"
     variation       1254
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:754006543"
     variation       1255
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1323190163"
     variation       1257
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:777728095"
     variation       1258
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1227322853"
     variation       1263
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1335000948"
     variation       1265
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:756152576"
     variation       1266
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1279530576"
     variation       1269
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1567595727"
     variation       1270..1271
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="gc"
                     /db_xref="dbSNP:1227140446"
     variation       1284
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1398149433"
     variation       1287
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:963756863"
     variation       1289
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1339721273"
     exon            1291..1924
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /inference="alignment:Splign:2.1.0"
     variation       1304
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1478792995"
     variation       1307
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1260973990"
     variation       1309
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1192333333"
     variation       1312
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368294497"
     variation       1313
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1328350299"
     variation       1316
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1291690177"
     variation       1317
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1340359693"
     variation       1320
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1208347535"
     variation       1323
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:202218344"
     variation       1325
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:780943523"
     variation       1326
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:200203162"
     variation       1327
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1347087732"
     variation       1330
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:751075535"
     variation       1331
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:766852114"
     variation       1333
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1251355219"
     variation       1336
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375656608"
     variation       1338
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:763527222"
     variation       1339
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:765618532"
     variation       1340
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:9912315"
     variation       1341
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:768840213"
     variation       1344
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:760815138"
     variation       1348..1350
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="ggg"
                     /db_xref="dbSNP:1208885081"
     variation       1352
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:775629594"
     variation       1354
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:1321956225"
     variation       1354
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:749255717"
     variation       1358
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1337392258"
     variation       1360
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:766274868"
     variation       1365
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1420752858"
     variation       1366..1367
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="ct"
                     /replace="ctct"
                     /db_xref="dbSNP:751988367"
     variation       1368
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:777533955"
     variation       1369
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:769734637"
     variation       1377
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1478309213"
     variation       1379
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374945200"
     variation       1383
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:747934368"
     variation       1384
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:781058023"
     variation       1385
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:371721675"
     variation       1387
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:751114635"
     variation       1389
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:779618547"
     variation       1390
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:757803996"
     variation       1391
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1272301681"
     variation       1393
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1220368001"
     variation       1395
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:750960349"
     variation       1397
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:765708269"
     variation       1402..1413
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="ccg"
                     /replace="ccgtgtaccccg"
                     /db_xref="dbSNP:766786518"
     variation       1402
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:762201526"
     variation       1403
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:149875713"
     variation       1404
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:141055939"
     variation       1405
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:750356848"
     variation       1407
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:4562"
     variation       1410
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1327600201"
     variation       1412
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:200370674"
     variation       1413
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:773251272"
     variation       1417
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1453607281"
     variation       1418
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:769849262"
     variation       1419
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1180753853"
     variation       1420..1422
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="cc"
                     /replace="ccc"
                     /db_xref="dbSNP:1567595367"
     variation       1420
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:761984728"
     variation       1421
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:748013881"
     variation       1422
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200825966"
     variation       1423
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:3744400"
     variation       1428
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200179958"
     variation       1430
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1035730816"
     variation       1432
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1277163550"
     variation       1433
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:139088043"
     variation       1435
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:373668129"
     variation       1438
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:745334807"
     variation       1444
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:150733809"
     variation       1446
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369723431"
     variation       1448
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:754288281"
     variation       1450
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:764449775"
     variation       1453
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:756396409"
     variation       1470
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:767612596"
     variation       1471
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:759702143"
     variation       1473
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376741365"
     variation       1474
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1160228957"
     variation       1476
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:931259883"
     variation       1480
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:139056264"
     variation       1482
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:761845015"
     variation       1483
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1039568345"
     variation       1484
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1473822214"
     variation       1485
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:942502314"
     variation       1487
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:776668453"
     variation       1491
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:768516015"
     variation       1495
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1288656088"
     variation       1496
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1214873941"
     variation       1496
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:34184791"
     variation       1499
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:775244828"
     variation       1501
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1470084160"
     variation       1505
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1419179338"
     variation       1510
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:912352748"
     variation       1511
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1001008709"
     variation       1524
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:554259644"
     variation       1525
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1021108252"
     variation       1526
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:537621453"
     variation       1529
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:576047180"
     variation       1531
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1241889835"
     variation       1532
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:935031475"
     variation       1535
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1280651152"
     variation       1540
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1009749031"
     variation       1546
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:746605493"
     variation       1547
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:557381253"
     variation       1548
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1461141895"
     variation       1550
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:979486034"
     variation       1559
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:969023075"
     variation       1567..1570
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="ct"
                     /replace="ctct"
                     /db_xref="dbSNP:1200654189"
     variation       1571
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1166223809"
     variation       1572
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1405473579"
     variation       1573..1575
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="ccc"
                     /replace="cccc"
                     /db_xref="dbSNP:899819649"
     variation       1574
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1183636853"
     variation       1579
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:539027720"
     variation       1580
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1157045535"
     variation       1585
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:558388188"
     variation       1587
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1435361730"
     variation       1589
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:991653031"
     variation       1596
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1400246504"
     variation       1599..1617
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="gggt"
                     /replace="gggttgggggtgggggggt"
                     /db_xref="dbSNP:919678612"
     variation       1602
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1393634741"
     variation       1609
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1555533340"
     variation       1610..1616
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="ggggggg"
                     /replace="gggggggg"
                     /db_xref="dbSNP:941419766"
     variation       1610
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:958863304"
     variation       1611
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1567595223"
     variation       1613
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1376587494"
     variation       1614
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1238469964"
     variation       1615
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1306569051"
     variation       1616
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1035782629"
     variation       1620
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1254896874"
     variation       1623..1628
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="tgg"
                     /replace="tggtgg"
                     /db_xref="dbSNP:1567595212"
     variation       1629..1634
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="gaga"
                     /replace="gagaga"
                     /db_xref="dbSNP:929144374"
     variation       1631
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:983213973"
     variation       1644
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:538554683"
     variation       1645
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1238754095"
     variation       1646
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1457119418"
     variation       1648
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1176563872"
     variation       1649
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1397052635"
     variation       1660
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1248697125"
     variation       1663
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:917787168"
     variation       1665
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1375977852"
     variation       1672
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1222348503"
     variation       1674
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1358832628"
     variation       1679
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1168959908"
     variation       1680
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:992476195"
     variation       1682
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1444953521"
     variation       1683
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1289754111"
     variation       1690
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:959346215"
     variation       1692
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1243677637"
     variation       1694
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1033743246"
     variation       1697
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1386975834"
     variation       1699
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1300223049"
     variation       1703..1706
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="cttc"
                     /replace="cttcttc"
                     /db_xref="dbSNP:1229010506"
     variation       1703
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1355817502"
     variation       1712
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:78296367"
     variation       1717
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1317231012"
     variation       1721
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:546663071"
     variation       1723
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1025666667"
     variation       1725
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:569905272"
     variation       1726
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:760872164"
     variation       1727
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:530122257"
     variation       1728
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1190801195"
     variation       1735
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1294933004"
     variation       1736
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:898445156"
     variation       1744..1745
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:35473892"
     variation       1744
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1430333819"
     variation       1750
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1020722035"
     variation       1755
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1171494040"
     variation       1757
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1404970657"
     variation       1760
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1464515135"
     variation       1761
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1167807993"
     variation       1762
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1040023623"
     variation       1768
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1006771157"
     variation       1769..1778
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="ttcag"
                     /replace="ttcagttcag"
                     /db_xref="dbSNP:757950075"
     variation       1778
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1161206552"
     variation       1795
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1457752302"
     variation       1796
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1215"
     variation       1798
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:551101037"
     variation       1799
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:935083831"
     variation       1800
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:923669811"
     variation       1801
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1043431244"
     variation       1811
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:900100787"
     variation       1818
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1216700220"
     variation       1824
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:946368418"
     variation       1825
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1322060802"
     variation       1831
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1220585287"
     variation       1834
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:185269004"
     variation       1836
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1194739869"
     variation       1840
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1262550233"
     variation       1841
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:779497605"
     variation       1844
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1266822694"
     variation       1848
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1423548472"
     variation       1849
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:557697234"
     variation       1855
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1347388342"
     variation       1856
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:958914936"
     variation       1859
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1567595082"
     variation       1860..1863
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="ct"
                     /replace="ctct"
                     /db_xref="dbSNP:926572189"
     variation       1860
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:937900774"
     variation       1861
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:1489200425"
     variation       1863..1864
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="tt"
                     /replace="ttt"
                     /db_xref="dbSNP:1397628601"
     variation       1877
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:928820753"
     variation       1881
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1294999988"
     variation       1886..1891
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="ctt"
                     /replace="cttctt"
                     /db_xref="dbSNP:1261270027"
     variation       1887..1892
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="tt"
                     /replace="ttcttt"
                     /db_xref="dbSNP:1227464068"
     variation       1888..1890
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="t"
                     /replace="tct"
                     /db_xref="dbSNP:1379823454"
     variation       1890..1895
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="ttt"
                     /replace="tttttt"
                     /db_xref="dbSNP:377718990"
     variation       1895
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1237970476"
     regulatory      1896..1901
                     /regulatory_class="polyA_signal_sequence"
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
     variation       1899..1905
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="aaaaaaa"
                     /replace="aaaaaaaa"
                     /db_xref="dbSNP:1285625284"
     regulatory      1904..1909
                     /regulatory_class="polyA_signal_sequence"
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
     variation       1904
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1303217687"
     variation       1906
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:565471914"
     variation       1907..1909
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="aaa"
                     /replace="aaaa"
                     /db_xref="dbSNP:1472757533"
     variation       1907
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1487325024"
     variation       1908
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1223748449"
     variation       1909
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:981552311"
     variation       1911
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:913606465"
     variation       1912
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:951524203"
     variation       1915
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1026141799"
     polyA_site      1924
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
ORIGIN      
ggaaaaaaaaggagagcagcgggtgggggcgaaagcagggccgaggagagagcactttggacagaacccggcggggaaagggcggcgccgaggcttgtcaggggcgccccgcagcgtcccaggcgcacctgttgggaagaaaggaaggggcttcccggtgttcgagggaaatccagtccggaggggctgactcggagcttgggactcctggggagccaccgcctcctccccagcggcggtcaaaaccgggcaagcgaaggggcgtgaccctggtgctcaggtttcttcctcctcacctgggcaaggaggggtgggggccacgacttccggttcaggtgagtgtcccttcggtgacgtcaggtcatcctcggccgcccctccggtcccgcctccccctcccgcgctcccggggcgcgcgggccgcgcccccgacgccctacatatactcaggtgcgccccacctgtccgcccgcacctgctggctcacctccgagccacctctgctgcgcaccgcagcctcggacctacagcccaggatactttgggacttgccggcgctcagaaacgcgcccagacggcccctccaccttttgtttgcctagggtcgccgagagcgcccggagggaaccgcctggccttcggggaccaccaattttgtctggaaccaccctcccggcgtatcctactccctgtgccgcgaggccatcgcttcactggaggggtcgatttgtgtgtagtttggtgacaagatttgcattcacctggcccaaaccctttttgtctctttgggtgaccggaaaactccacctcaagttttcttttgtggggctgccccccaagtgtcgtttgttttactgtagggtctccccgcccggcgcccccagtgttttctgagggcggaaatggccaattcgggcctgcagttgctgggcttctccatggccctgctgggctgggtgggtctggtggcctgcaccgccatcccgcagtggcagatgagctcctatgcgggtgacaacatcatcacggcccaggccatgtacaaggggctgtggatggactgcgtcacgcagagcacggggatgatgagctgcaaaatgtacgactcggtgctcgccctgtccgcggccttgcaggccactcgagccctaatggtggtctccctggtgctgggcttcctggccatgtttgtggccacgatgggcatgaagtgcacgcgctgtgggggagacgacaaagtgaagaaggcccgtatagccatgggtggaggcataattttcatcgtggcaggtatgagtttggccctgccatctttattggctgggcagggtctgccctagtcatcctgggaggtgcactgctctcctgttcctgtcctgggaatgagagcaaggctgggtaccgtgtaccccgctcttaccctaagtccaactcttccaaggagtatgtgtgacctgggatctccttgccccagcctgacaggctatgggagtgtctagatgcctgaaagggcctggggctgagctcagcctgtgggcagggtgccggacaaaggcctcctggtcactctgtccctgcactccatgtatagtcctcttgggttgggggtgggggggtgccgttggtgggagagacaaaaagagggagagtgtgctttttgtacagtaataaaaaataagtattgggaagcaggcttttttcccttcagggcctctgctttcctcccgtccagatccttgcagggagcttggaaccttagtgcacctacttcagttcagaacacttagcaccccactgactccactgacaattgactaaaagatgcaggtgctcgtatctcgacattcattcccacccccctcttatttaaatagctaccaaagtacttcttttttaataaaaaaataaagatttttattaggtaaaaaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]