GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-07-16 03:45:45, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       NM_001184312             303 bp    mRNA    linear   PLN 23-JAN-2026
DEFINITION  Saccharomyces cerevisiae S288C 60S ribosomal protein eL36 RPL36B
            (RPL36B), partial mRNA.
ACCESSION   NM_001184312
VERSION     NM_001184312.1
DBLINK      BioProject: PRJNA128
KEYWORDS    RefSeq.
SOURCE      Saccharomyces cerevisiae S288C
  ORGANISM  Saccharomyces cerevisiae S288C
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Saccharomyces.
REFERENCE   1  (bases 1 to 303)
  AUTHORS   Engel,S.R., Wong,E.D., Nash,R.S., Aleksander,S., Alexander,M.,
            Douglass,E., Karra,K., Miyasato,S.R., Simison,M., Skrzypek,M.S.,
            Weng,S. and Cherry,J.M.
  TITLE     New data and collaborations at the Saccharomyces Genome Database:
            updated reference genome, alleles, and the Alliance of Genome
            Resources
  JOURNAL   Genetics 220 (4) (2022)
   PUBMED   34897464
REFERENCE   2  (bases 1 to 303)
  AUTHORS   Bussey,H., Storms,R.K., Ahmed,A., Albermann,K., Allen,E.,
            Ansorge,W., Araujo,R., Aparicio,A., Barrell,B., Badcock,K.,
            Benes,V., Botstein,D., Bowman,S., Bruckner,M., Carpenter,J.,
            Cherry,J.M., Chung,E., Churcher,C., Coster,F., Davis,K.,
            Davis,R.W., Dietrich,F.S., Delius,H., DiPaolo,T., Hani,J. et al.
  TITLE     The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI
  JOURNAL   Nature 387 (6632 SUPPL), 103-105 (1997)
   PUBMED   9169875
REFERENCE   3  (bases 1 to 303)
  AUTHORS   Goffeau,A., Barrell,B.G., Bussey,H., Davis,R.W., Dujon,B.,
            Feldmann,H., Galibert,F., Hoheisel,J.D., Jacq,C., Johnston,M.,
            Louis,E.J., Mewes,H.W., Murakami,Y., Philippsen,P., Tettelin,H. and
            Oliver,S.G.
  TITLE     Life with 6000 genes
  JOURNAL   Science 274 (5287), 546 (1996)
   PUBMED   8849441
REFERENCE   4  (bases 1 to 303)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (23-JAN-2026) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 303)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2015) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
  REMARK    Protein update by submitter
REFERENCE   6  (bases 1 to 303)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (31-MAR-2011) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
  REMARK    Sequence update by submitter
REFERENCE   7  (bases 1 to 303)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (14-DEC-2009) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by SGD. This record
            is derived from an annotated genomic sequence (NC_001148).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: SGD
            Annotation Status   :: Full Annotation
            Annotation Version  :: R64-4-1
            URL                 :: http://www.yeastgenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..303
                     /organism="Saccharomyces cerevisiae S288C"
                     /mol_type="mRNA"
                     /strain="S288C"
                     /db_xref="taxon:559292"
                     /chromosome="XVI"
     gene            <1..>303
                     /gene="RPL36B"
                     /locus_tag="YPL249C-A"
                     /db_xref="GeneID:855826"
     CDS             1..303
                     /gene="RPL36B"
                     /locus_tag="YPL249C-A"
                     /experiment="EXISTENCE:direct assay:GO:0002181 cytoplasmic
                     translation [PMID:18782943]"
                     /experiment="EXISTENCE:direct assay:GO:0003723 RNA binding
                     [PMID:6337137]"
                     /experiment="EXISTENCE:direct assay:GO:0003735 structural
                     constituent of ribosome [PMID:18782943]"
                     /experiment="EXISTENCE:direct assay:GO:0022625 cytosolic
                     large ribosomal subunit [PMID:18782943]"
                     /experiment="EXISTENCE:mutant phenotype:GO:0000470
                     maturation of LSU-rRNA [PMID:37865285]"
                     /experiment="EXISTENCE:mutant phenotype:GO:0180023
                     cytosolic large ribosomal subunit assembly
                     [PMID:37865285]"
                     /note="Ribosomal 60S subunit protein L36B; binds to 5.8 S
                     rRNA; homologous to mammalian ribosomal protein L36, no
                     bacterial homolog; RPL36B has a paralog, RPL36A, that
                     arose from the whole genome duplication"
                     /codon_start=1
                     /product="60S ribosomal protein eL36 RPL36B"
                     /protein_id="NP_015074.1"
                     /db_xref="GeneID:855826"
                     /db_xref="SGD:S000006438"
                     /translation="
MAVKTGIAIGLNKGKKVTQMTPAPKISYKKGAASNRTKFVRSLVREIAGLSPYERRLIDLIRNSGEKRARKVAKKRLGSFTRAKAKVEEMNNIIAASRRH"
     misc_feature    10..297
                     /gene="RPL36B"
                     /locus_tag="YPL249C-A"
                     /note="Ribosomal protein L36e; Region: Ribosomal_L36e;
                     pfam01158"
                     /db_xref="CDD:460088"
ORIGIN      
atggctgtcaagactggtatcgctattggtttgaacaagggtaagaaagtcacccaaatgactccagccccaaagatctcctacaagaagggtgctgcctccaacagaaccaagttcgtcagatctttggttagagaaatcgccggtttgtccccatatgaaagaagattgatcgatttgatcagaaactccggtgaaaagagagccagaaaggtcgccaagaagagattgggttctttcaccagagccaaggctaaggtcgaagaaatgaacaacatcattgctgcctctcgtcgtcattaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]