GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-09-18 09:47:24, GGRNA.v2 : RefSeq release 231 (Jul, 2025)

LOCUS       NM_001177326            1228 bp    mRNA    linear   ROD 23-JUN-2025
DEFINITION  Rattus norvegicus homeobox C8 (Hoxc8), mRNA.
ACCESSION   NM_001177326
VERSION     NM_001177326.2
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1228)
  AUTHORS   Vermot,J., Schuhbaur,B., Le Mouellic,H., McCaffery,P.,
            Garnier,J.M., Hentsch,D., Brulet,P., Niederreither,K., Chambon,P.,
            Dolle,P. and Le Roux,I.
  TITLE     Retinaldehyde dehydrogenase 2 and Hoxc8 are required in the murine
            brachial spinal cord for the specification of Lim1+ motoneurons and
            the correct distribution of Islet1+ motoneurons
  JOURNAL   Development 132 (7), 1611-1621 (2005)
   PUBMED   15753214
REFERENCE   2  (bases 1 to 1228)
  AUTHORS   Bayarsaihan,D., Bitchevaia,N., Enkhmandakh,B., Tussie-Luna,M.I.,
            Leckman,J.F., Roy,A. and Ruddle,F.
  TITLE     Expression of BEN, a member of TFII-I family of transcription
            factors, during mouse pre- and postimplantation development
  JOURNAL   Gene Expr Patterns 3 (5), 579-589 (2003)
   PUBMED   12971990
REFERENCE   3  (bases 1 to 1228)
  AUTHORS   Nauta,A.J., Daha,M.R., Tijsma,O., van de Water,B., Tedesco,F. and
            Roos,A.
  TITLE     The membrane attack complex of complement induces caspase
            activation and apoptosis
  JOURNAL   Eur J Immunol 32 (3), 783-792 (2002)
   PUBMED   11870622
REFERENCE   4  (bases 1 to 1228)
  AUTHORS   van den Akker,E., Fromental-Ramain,C., de Graaff,W., Le
            Mouellic,H., Brulet,P., Chambon,P. and Deschamps,J.
  TITLE     Axial skeletal patterning in mice lacking all paralogous group 8
            Hox genes
  JOURNAL   Development 128 (10), 1911-1921 (2001)
   PUBMED   11311170
REFERENCE   5  (bases 1 to 1228)
  AUTHORS   Schnabel,C.A. and Abate-Shen,C.
  TITLE     Repression by HoxA7 is mediated by the homeodomain and the
            modulatory action of its N-terminal-arm residues
  JOURNAL   Mol Cell Biol 16 (6), 2678-2688 (1996)
   PUBMED   8649375
REFERENCE   6  (bases 1 to 1228)
  AUTHORS   Sakoyama,Y., Mizuta,I., Ogasawara,N. and Yoshikawa,H.
  TITLE     Cloning of rat homeobox genes
  JOURNAL   Biochem Genet 32 (9-10), 351-360 (1994)
   PUBMED   7702549
REFERENCE   7  (bases 1 to 1228)
  AUTHORS   Pellerin,I., Schnabel,C., Catron,K.M. and Abate,C.
  TITLE     Hox proteins have different affinities for a consensus DNA site
            that correlate with the positions of their genes on the hox cluster
  JOURNAL   Mol Cell Biol 14 (7), 4532-4545 (1994)
   PUBMED   7911971
REFERENCE   8  (bases 1 to 1228)
  AUTHORS   Chung,S.Y., Dai,P.H., Lei,J., Riviere,M., Levan,G., Szpirer,J. and
            Szpirer,C.
  TITLE     Chromosomal assignment of seven rat homeobox genes to rat
            chromosomes 3, 4, 7, and 10
  JOURNAL   Mamm Genome 4 (9), 537-540 (1993)
   PUBMED   7906969
REFERENCE   9  (bases 1 to 1228)
  AUTHORS   Falzon,M. and Chung,S.Y.
  TITLE     The expression of rat homeobox-containing genes is developmentally
            regulated and tissue specific
  JOURNAL   Development 103 (3), 601-610 (1988)
   PUBMED   2907739
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            JAXUCZ010000007.1.
            
            On Oct 20, 2010 this sequence version replaced NM_001177326.1.
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.
            
            ##Evidence-Data-START##
            Transcript exon combination :: SRR26643288.32645.1,
                                           SRR26643295.30564.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA5760386, SAMEA5760475
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-436               JAXUCZ010000007.1  136006407-136006842
            437-1228            JAXUCZ010000007.1  136008182-136008973
FEATURES             Location/Qualifiers
     source          1..1228
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN"
                     /db_xref="taxon:10116"
                     /chromosome="7"
                     /map="7q36"
     gene            1..1228
                     /gene="Hoxc8"
                     /gene_synonym="Hox3r4"
                     /note="homeobox C8"
                     /db_xref="GeneID:24460"
                     /db_xref="RGD:2821"
     CDS             1..729
                     /gene="Hoxc8"
                     /gene_synonym="Hox3r4"
                     /note="homeobox protein R4; Homeobox gene C8; homeo box
                     C8"
                     /codon_start=1
                     /product="homeobox protein Hox-C8"
                     /protein_id="NP_001170797.2"
                     /db_xref="GeneID:24460"
                     /db_xref="RGD:2821"
                     /translation="
MSSYFVNPLFSKYKGGESLEPAYYDCRFPQSVGRSHALVYGPGGSAPGFQHASHHVQDFFHHGTSGISNSGYQQNPCSLSCHGDASKFYGYEALPRQSLYGAQQEASVVQYPDCKSSANTNSSEGQGHLNQNSSPSLMFPWMRPHAPGRRSGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKLPGARDEEKVEEEGNEEEEKEEEEKEENKD"
     misc_feature    448..618
                     /gene="Hoxc8"
                     /gene_synonym="Hox3r4"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     exon            1..436
                     /gene="Hoxc8"
                     /gene_synonym="Hox3r4"
                     /inference="alignment:Splign:2.1.0"
     exon            437..1228
                     /gene="Hoxc8"
                     /gene_synonym="Hox3r4"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
atgagctcctacttcgtcaaccccctgttctccaaatacaaaggcggcgagtccctggaaccggcctattacgactgccggttccctcagagcgtgggcagaagccatgcgctggtgtacgggcccggcggctcagcgcccggcttccagcacgcctcgcaccacgtccaagacttcttccaccacggcacctccggcatctccaactcgggctaccagcagaacccgtgctcgctgagctgccacggagacgcctccaaattctatggctacgaggcgctccccagacagtccctttatggggctcagcaagaggcgagcgtggtgcaatatcccgactgtaaatcctccgccaacactaacagtagcgaaggacaaggccacttaaatcagaactcgtctcccagcctcatgtttccatggatgagaccccacgctcctgggcggcgcagcggacgacaaacttacagccggtatcagaccttggaactagagaaggagtttctctttaatccttatttgaccagaaagcgccggattgaagtctctcacgccctgggactgacggaaagacaagtgaagatttggttccagaatcgaaggatgaagtggaaaaaggagaacaacaaggataaacttcctggggcccgagatgaggagaaggtggaagaagaagggaatgaggaagaggagaaggaggaggaggaaaaggaagaaaataaggactaagaaaaaagagaaaatcagccccccccacaactcccttgaagtttcgttttatggtagcagataaattgagaagtttacgactgtcatttgcttttatagagaatagaatgacactcacaactgtaactacctgtcagatagttgcagctctgcttttattacctttggccttcccccactctttatttgtctgggggttgggagggggaacctgagacacagggaaaagttctgttccactccatgcccagcacacactcacttgtccctacttccacttctgagcccttcccgataaagcctaaccctacacacacacacacacacacacacacacacacacacacacacaccacacacacttctctccacactctttacacgattctctggtatttattttaaaagggattcccctgaagatgtagaagatgattcctggctttgcttgtatgctgggaattagaatactggattgacttttttttttaaatgaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]