2024-04-21 00:03:07, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001172204 885 bp mRNA linear VRT 21-JUN-2021 DEFINITION Xenopus laevis ventral anterior homeobox 2 S homeolog (vax2.S), mRNA. ACCESSION NM_001172204 VERSION NM_001172204.1 KEYWORDS RefSeq. SOURCE Xenopus laevis (African clawed frog) ORGANISM Xenopus laevis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Xenopus. COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from AF113517.1. ##Evidence-Data-START## Transcript exon combination :: AF113517.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN04111048, SAMN04111049 [ECO:0000348] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..885 /organism="Xenopus laevis" /mol_type="mRNA" /db_xref="taxon:8355" /chromosome="1S" /map="1S" gene 1..885 /gene="vax2.S" /gene_synonym="dres93; vax2-a; vax2-b; vax3; xvax2" /note="ventral anterior homeobox 2 S homeolog" /db_xref="GeneID:100337605" /db_xref="Xenbase:XB-GENE-6464314" CDS 1..885 /gene="vax2.S" /gene_synonym="dres93; vax2-a; vax2-b; vax3; xvax2" /note="ventral anterior homeobox 3" /codon_start=1 /product="ventral anterior homeobox 2b" /protein_id="NP_001165675.1" /db_xref="GeneID:100337605" /db_xref="Xenbase:XB-GENE-6464314" /translation="
MGDGVSEERSPLCGKSATSCSERVRDRGTRADLECSLRGHSLKDIPVTSTSSPGSSKEEVLDSQSPGEADYCRRILVRDAKGTIREIVLPKGLDLDRPKRTRTSFTAEQLYRLELEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKKDQSRDSEKRSSSTSESFATCNILRLLEQGRLLSVPAPPNMISSQNNMGTSSGNGTSLGTSGSTSPVISTTPPGAGAFSLQVPSLAASSSPRLPTPFYFPGPLLGGLHEIPSGYGLGSSAFEPYTRLDRKDTASGKKSTS"
misc_feature 1..81 /gene="vax2.S" /gene_synonym="dres93; vax2-a; vax2-b; vax3; xvax2" /note="propagated from UniProtKB/Swiss-Prot (Q9IAX9.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 127..195 /gene="vax2.S" /gene_synonym="dres93; vax2-a; vax2-b; vax3; xvax2" /note="propagated from UniProtKB/Swiss-Prot (Q9IAX9.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 208..294 /gene="vax2.S" /gene_synonym="dres93; vax2-a; vax2-b; vax3; xvax2" /note="Region: vax upstream domain" misc_feature 292..474 /gene="vax2.S" /gene_synonym="dres93; vax2-a; vax2-b; vax3; xvax2" /note="Region: homeobox" misc_feature order(295..309,313..315,364..366,382..384,421..423, 427..432,439..444,448..456,460..465) /gene="vax2.S" /gene_synonym="dres93; vax2-a; vax2-b; vax3; xvax2" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 301..462 /gene="vax2.S" /gene_synonym="dres93; vax2-a; vax2-b; vax3; xvax2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature order(301..303,310..312,430..432,439..444,451..453) /gene="vax2.S" /gene_synonym="dres93; vax2-a; vax2-b; vax3; xvax2" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 529..564 /gene="vax2.S" /gene_synonym="dres93; vax2-a; vax2-b; vax3; xvax2" /note="Region: vax downstream domain" misc_feature 568..669 /gene="vax2.S" /gene_synonym="dres93; vax2-a; vax2-b; vax3; xvax2" /note="propagated from UniProtKB/Swiss-Prot (Q9IAX9.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 817..840 /gene="vax2.S" /gene_synonym="dres93; vax2-a; vax2-b; vax3; xvax2" /note="Region: vax terminal domain" exon 1..235 /gene="vax2.S" /gene_synonym="dres93; vax2-a; vax2-b; vax3; xvax2" /inference="alignment:Splign:2.1.0" exon 236..423 /gene="vax2.S" /gene_synonym="dres93; vax2-a; vax2-b; vax3; xvax2" /inference="alignment:Splign:2.1.0" exon 424..885 /gene="vax2.S" /gene_synonym="dres93; vax2-a; vax2-b; vax3; xvax2" /inference="alignment:Splign:2.1.0" ORIGIN
atgggcgatggagtgtccgaggagagaagccctctgtgtggcaaatcagccacatcttgttcagaacgagtcagagacaggggaacaagggctgatctggagtgctccttgcgaggccacagtcttaaggacattcctgtgacctccacctccagtcccggctcatccaaggaagaggttctggacagccagtccccaggagaagctgattactgtcgacggatcctggtcagagatgccaaagggacaatcagggagattgttctcccaaagggcctggatcttgatcgacccaaacgtaccagaacatccttcacagctgaacagctttaccgcctggagctggaattccagaggtgccaatatgttgttggcagagagaggacagagctggcaaggcaactcaatctgtcagaaacccaggtcaaagtttggtttcagaacagaagaacgaaacagaaaaaagatcagagtagggactctgagaaacgttcttcttccacttccgaatcctttgctacttgcaatattttgcgattgttggaacaaggcagacttttgtcagtcccagcaccaccgaatatgatctctagtcaaaacaacatgggcacttcatcgggaaatggaaccagcctggggacatcgggaagcacttcaccagtcatcagtactacacctcctggagcaggagctttcagcttacaagttccatcattagcagcctcatcttctccaaggttaccgacccctttttattttcctggtcctctattgggaggtctgcatgaaataccctcagggtatggactgggaagctctgcttttgagccttacactcgcctggataggaaagacactgcttcaggcaagaagtcaacttcttaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]