ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-01-09 01:45:12, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS NM_001166313 972 bp mRNA linear MAM 02-APR-2025
DEFINITION Sus scrofa cyclin H (CCNH), mRNA.
ACCESSION NM_001166313
VERSION NM_001166313.1
KEYWORDS RefSeq.
SOURCE Sus scrofa (pig)
ORGANISM Sus scrofa
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Laurasiatheria; Artiodactyla; Suina; Suidae;
Sus.
REFERENCE 1 (bases 1 to 972)
AUTHORS Fujii,W., Nishimura,T., Kano,K., Sugiura,K. and Naito,K.
TITLE CDK7 and CCNH are components of CDK-activating kinase and are
required for meiotic progression of pig oocytes
JOURNAL Biol Reprod 85 (6), 1124-1132 (2011)
PUBMED 21778139
REMARK GeneRIF: CDK7 and CCNH activate CDC2 by T161 phosphorylation and
make up CDK-activating kinase, which is required for normal meiotic
progression during porcine oocyte maturation.
COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
NCBI review. The reference sequence was derived from AB499892.1.
##Evidence-Data-START##
Transcript exon combination :: AB499892.1, SRR5275317.44162.1
[ECO:0000332]
RNAseq introns :: single sample supports all introns
SAMEA103886115 [ECO:0000348]
##Evidence-Data-END##
FEATURES Location/Qualifiers
source 1..972
/organism="Sus scrofa"
/mol_type="mRNA"
/db_xref="taxon:9823"
/chromosome="2"
/map="2"
gene 1..972
/gene="CCNH"
/note="cyclin H"
/db_xref="GeneID:100310796"
/db_xref="RGD:14197493"
/db_xref="VGNC:VGNC:86359"
CDS 1..972
/gene="CCNH"
/codon_start=1
/product="cyclin-H"
/protein_id="NP_001159785.1"
/db_xref="GeneID:100310796"
/db_xref="RGD:14197493"
/db_xref="VGNC:VGNC:86359"
/translation="
MYHNSSQKRHWTFASEEQLARLRADANRKFRCKAVANGKVLPNDPIFLEPHEEMILCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPMLENPEILRKTADDFLSRVALTDAHLLYTPSQIALTAILSSASRAGITMESYLSESLMLKENRTSLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERCHSPELALNVITKKRKGYEDDDYVSKKSKHEEEEWTDDDLVDSL"
misc_feature 4..924
/gene="CCNH"
/note="cyclin ccl1; Region: ccl1; TIGR00569"
/db_xref="CDD:129660"
exon 1..117
/gene="CCNH"
/inference="alignment:Splign:2.1.0"
exon 118..240
/gene="CCNH"
/inference="alignment:Splign:2.1.0"
exon 241..314
/gene="CCNH"
/inference="alignment:Splign:2.1.0"
exon 315..525
/gene="CCNH"
/inference="alignment:Splign:2.1.0"
exon 526..689
/gene="CCNH"
/inference="alignment:Splign:2.1.0"
exon 690..760
/gene="CCNH"
/inference="alignment:Splign:2.1.0"
exon 761..872
/gene="CCNH"
/inference="alignment:Splign:2.1.0"
exon 873..933
/gene="CCNH"
/inference="alignment:Splign:2.1.0"
exon 934..972
/gene="CCNH"
/inference="alignment:Splign:2.1.0"
ORIGIN
atgtaccacaatagtagccagaagcggcactggactttcgccagtgaggagcagctagcccggttgcgggccgacgccaaccgcaaattcagatgcaaagcagtggcgaatgggaaggttcttccaaatgacccaatctttcttgagcctcatgaagaaatgatactctgcaaatactatgagaaaagattattggaattctgttcagtgtttaagccagcaatgccaaggtctgttgtgggtacggcttgtatgtatttcaagcgtttttatcttaataactcagttatggaatatcacccccggataataatgctcacttgtgcatttttggcctgcaaggtagatgaattcaatgtatctagtccacaatttgttggaaatctgcgggagagtcctcttggacaagagaaagcacttgaacagattttggaatatgaactgctccttatacaacagcttaatttccaccttattgtccacaatccttatagaccttttgagggctttctcattgatttaaagactcgatatcccatgttggagaatccagagattttgaggaagacagctgatgactttctcagtagagttgcattgacggatgctcaccttttatacacaccttcccagattgccctgactgccattttatctagtgcatccagagcaggaattactatggaaagttatttatcagaaagtctgatgctcaaagagaacagaactagcctgtcacagttactagatattatgaaaagcatgagaaacttggtaaaaaaatatgaaccacccagatctgaagaagttgctgttctgaaacagaagttggagagatgtcactctcctgagcttgcacttaacgtaattaccaagaagaggaaaggttatgaagatgatgattatgtctcaaagaaatccaaacatgaggaggaagaatggactgatgatgacctggtagattccctgtaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]