GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2020-04-07 23:08:00, GGRNA.v2 : RefSeq release 99 (Mar, 2020)

LOCUS       NM_001160097            1092 bp    mRNA    linear   ROD 24-SEP-2019
DEFINITION  Mus musculus claudin 10 (Cldn10), transcript variant a_v2, mRNA.
ACCESSION   NM_001160097
VERSION     NM_001160097.1
KEYWORDS    RefSeq.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 1092)
  AUTHORS   Breiderhoff T, Himmerkus N, Drewell H, Plain A, Gunzel D, Mutig K,
            Willnow TE, Muller D and Bleich M.
  TITLE     Deletion of claudin-10 rescues claudin-16-deficient mice from
            hypomagnesemia and hypercalciuria
  JOURNAL   Kidney Int. 93 (3), 580-588 (2018)
   PUBMED   29129401
  REMARK    GeneRIF: Severe individual renal phenotypes in claudin-10 and
            claudin-16 knockout mice are corrected by the additional deletion
            of the other claudin.
REFERENCE   2  (bases 1 to 1092)
  AUTHORS   Hadj-Rabia S, Brideau G, Al-Sarraj Y, Maroun RC, Figueres ML,
            Leclerc-Mercier S, Olinger E, Baron S, Chaussain C, Nochy D, Taha
            RZ, Knebelmann B, Joshi V, Curmi PA, Kambouris M, Vargas-Poussou R,
            Bodemer C, Devuyst O, Houillier P and El-Shanti H.
  TITLE     Multiplex epithelium dysfunction due to CLDN10 mutation: the HELIX
            syndrome
  JOURNAL   Genet. Med. 20 (2), 190-201 (2018)
   PUBMED   28771254
  REMARK    GeneRIF: ConclusionCLDN10 mutations cause a dysfunction in TJs in
            several tissues and, subsequently, abnormalities in renal ion
            transport, ectodermal gland homeostasis, and epidermal integrity.
REFERENCE   3  (bases 1 to 1092)
  AUTHORS   Perez EC, Xander P, Laurindo MFL, Novaes E Brito RR, Vivanco BC,
            Mortara RA, Mariano M, Lopes JD and Keller AC.
  TITLE     The axis IL-10/claudin-10 is implicated in the modulation of
            aggressiveness of melanoma cells by B-1 lymphocytes
  JOURNAL   PLoS ONE 12 (11), e0187333 (2017)
   PUBMED   29145406
  REMARK    GeneRIF: findings suggest that the axis IL-10/claudin-10 is a
            promising target for the development of therapeutic agents against
            aggressive melanoma
            Publication Status: Online-Only
REFERENCE   4  (bases 1 to 1092)
  AUTHORS   Milatz S, Himmerkus N, Wulfmeyer VC, Drewell H, Mutig K, Hou J,
            Breiderhoff T, Muller D, Fromm M, Bleich M and Gunzel D.
  TITLE     Mosaic expression of claudins in thick ascending limbs of Henle
            results in spatial separation of paracellular Na+ and Mg2+
            transport
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 114 (2), E219-E227 (2017)
   PUBMED   28028216
REFERENCE   5  (bases 1 to 1092)
  AUTHORS   Schumann S, Buck VU, Classen-Linke I, Wennemuth G and Grummer R.
  TITLE     Claudin-3, claudin-7, and claudin-10 show different distribution
            patterns during decidualization and trophoblast invasion in mouse
            and human
  JOURNAL   Histochem. Cell Biol. 144 (6), 571-585 (2015)
   PUBMED   26340953
  REMARK    GeneRIF: localization of Cldn3, Cldn7 and Cldn10 proteins in the
            different compartments of murine endometrium up to day 8.5 of
            pregnancy (dpc) as well as in human endometrium and first trimester
            decidua
REFERENCE   6  (bases 1 to 1092)
  AUTHORS   Kitajiri SI, Furuse M, Morita K, Saishin-Kiuchi Y, Kido H, Ito J
            and Tsukita S.
  TITLE     Expression patterns of claudins, tight junction adhesion molecules,
            in the inner ear
  JOURNAL   Hear. Res. 187 (1-2), 25-34 (2004)
   PUBMED   14698084
  REMARK    GeneRIF: Claudin-10 is expressed at the variety of epithelial
            tissues in the coclea of inner ear including Organ of Corti, stria
            vascularis, Reissner's membrane, and spiral limbus.
REFERENCE   7  (bases 1 to 1092)
  AUTHORS   VanBuren V, Piao Y, Dudekula DB, Qian Y, Carter MG, Martin PR,
            Stagg CA, Bassey UC, Aiba K, Hamatani T, Kargul GJ, Luo AG, Kelso
            J, Hide W and Ko MS.
  TITLE     Assembly, verification, and initial annotation of the NIA mouse
            7.4K cDNA clone set
  JOURNAL   Genome Res. 12 (12), 1999-2003 (2002)
   PUBMED   12466305
REFERENCE   8  (bases 1 to 1092)
  AUTHORS   Turksen K and Troy TC.
  TITLE     Permeability barrier dysfunction in transgenic mice overexpressing
            claudin 6
  JOURNAL   Development 129 (7), 1775-1784 (2002)
   PUBMED   11923212
REFERENCE   9  (bases 1 to 1092)
  AUTHORS   Niimi T, Nagashima K, Ward JM, Minoo P, Zimonjic DB, Popescu NC and
            Kimura S.
  TITLE     claudin-18, a novel downstream target gene for the T/EBP/NKX2.1
            homeodomain transcription factor, encodes lung- and
            stomach-specific isoforms through alternative splicing
  JOURNAL   Mol. Cell. Biol. 21 (21), 7380-7390 (2001)
   PUBMED   11585919
REFERENCE   10 (bases 1 to 1092)
  AUTHORS   Morita K, Sasaki H, Fujimoto K, Furuse M and Tsukita S.
  TITLE     Claudin-11/OSP-based tight junctions of myelin sheaths in brain and
            Sertoli cells in testis
  JOURNAL   J. Cell Biol. 145 (3), 579-588 (1999)
   PUBMED   10225958
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from CA467408.1, AK020131.1,
            CK332009.1 and AI851016.1.
            
            Summary: This intronless gene encodes a member of the claudin
            family. Claudins are integral membrane proteins and components of
            tight unction strands. Tight junction strands serve as a physical
            barrier to prevent solutes and water from passing freely through
            the paracellular space between epithelial or endothelial cell
            sheets, and also play critical roles in maintaining cell polarity
            and signal transductions. Six alternatively spliced transcript
            variants have been identified, which encode different isoforms with
            distinct electric charge of the first extracellular loop and with
            or without the fourth transmembrane region. These isoforms exhibit
            distinct localization and function in paracellular anion or cation
            permeability. [provided by RefSeq, Aug 2010].
            
            Transcript Variant: This variant (a_v2) lacks an alternate in-frame
            exon in the 3' coding region, compared to variant a. The resulting
            isoform (a_i2) lacks an internal segment including the entire
            fourth transmembrane region, compared to isoform a. This variant is
            expressed only in kidney and uterus.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC021770.1 [ECO:0000332]
            RNAseq introns              :: mixed/partial sample support
                                           SAMN00849385 [ECO:0000350]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-37                CA467408.1         38-74
            38-589              AK020131.1         2-553
            590-744             CK332009.1         155-309
            745-1092            AI851016.1         1-348               c
FEATURES             Location/Qualifiers
     source          1..1092
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="14"
                     /map="14 62.55 cM"
     gene            1..1092
                     /gene="Cldn10"
                     /gene_synonym="6720456I16Rik; Cldn10a; Cldn10b;
                     D14Ertd728e"
                     /note="claudin 10"
                     /db_xref="GeneID:58187"
                     /db_xref="MGI:MGI:1913101"
     exon            1..500
                     /gene="Cldn10"
                     /gene_synonym="6720456I16Rik; Cldn10a; Cldn10b;
                     D14Ertd728e"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    197..199
                     /gene="Cldn10"
                     /gene_synonym="6720456I16Rik; Cldn10a; Cldn10b;
                     D14Ertd728e"
                     /note="upstream in-frame stop codon"
     CDS             287..868
                     /gene="Cldn10"
                     /gene_synonym="6720456I16Rik; Cldn10a; Cldn10b;
                     D14Ertd728e"
                     /note="isoform a_i2 is encoded by transcript variant a_v2;
                     claudin-10A; claudin 10B"
                     /codon_start=1
                     /product="claudin-10 isoform a_i2"
                     /protein_id="NP_001153569.1"
                     /db_xref="CCDS:CCDS49566.1"
                     /db_xref="GeneID:58187"
                     /db_xref="MGI:MGI:1913101"
                     /translation="
MSRAQISALVCGVGGFGALVAATTSNEWKVTTRASSVITATWVYQGLWMNCAGNALGSFHCRPHFTIFKVEGYIQACRGLMIAAVSLGFFGSIFALFGMKCTKVGGSDQAKAKIACLAGIVFILSGLCSMTGCSLYANKITTEFFDPLYMEQKMGYTYNGPTSAMSSRTKYQGGEGDFKTTGPSKQFDKNAYV"
     misc_feature    311..730
                     /gene="Cldn10"
                     /gene_synonym="6720456I16Rik; Cldn10a; Cldn10b;
                     D14Ertd728e"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:304458"
     exon            501..662
                     /gene="Cldn10"
                     /gene_synonym="6720456I16Rik; Cldn10a; Cldn10b;
                     D14Ertd728e"
                     /inference="alignment:Splign:2.1.0"
     exon            663..744
                     /gene="Cldn10"
                     /gene_synonym="6720456I16Rik; Cldn10a; Cldn10b;
                     D14Ertd728e"
                     /inference="alignment:Splign:2.1.0"
     exon            745..1078
                     /gene="Cldn10"
                     /gene_synonym="6720456I16Rik; Cldn10a; Cldn10b;
                     D14Ertd728e"
                     /inference="alignment:Splign:2.1.0"
     regulatory      1060..1065
                     /regulatory_class="polyA_signal_sequence"
                     /gene="Cldn10"
                     /gene_synonym="6720456I16Rik; Cldn10a; Cldn10b;
                     D14Ertd728e"
     polyA_site      1078
                     /gene="Cldn10"
                     /gene_synonym="6720456I16Rik; Cldn10a; Cldn10b;
                     D14Ertd728e"
ORIGIN      
aacaagagaaaaaaatatctgcagtaccaacaccttcaagattcctctacaaagttttggtatttcagtagggaattagaaagattattctaagctatctctaagatgcccttagtgtgatatactttattctaatttcccacacttcaagccatgagattatgaagaattgtcacctaccctcatgggctggctttaacattcgtggaagttttgtccagtgtctgcatgcctaggccaccaaagccttctgtgtggactgtggcagcaggcaaggctgagcgacatgtccagggcacagatctcagctctggtgtgtggtgttggagggtttggtgctctcgtcgctgccaccacatccaacgaatggaaagtgaccacccgagcgtcgtctgtgattaccgccacctgggtttaccagggtctgtggatgaactgcgcaggtaacgctctgggctccttccactgccggccacatttcactatcttcaaagtagaaggttacatccaggcatgtagaggactaatgatcgctgcggtcagcctgggatttttcggttccatttttgcactctttggaatgaaatgtaccaaagtcggaggctcagatcaagccaaagctaaaattgcttgcttggccgggattgtattcatattgtcaggtctgtgttccatgacaggctgttccctgtatgcaaacaaaatcacaacagaattctttgatcctctttatatggagcaaaaaatgggctacacatacaacggacccacgtctgccatgtcttctcggaccaagtatcaaggcggagaaggagattttaaaaccacaggcccttcaaaacagtttgataaaaatgcctatgtctaaagagctctggcaagctgcctcctgagttttgttgtgcaagagaactgtcctcacaatagtccttccaaggctctcctgtaattactgcttaagctgttttttaaaaatataaatttgaagactgttaattggatgtaaatgttcttatagttatatactaatcattttctgctgtgcctttctgtaagggaaataaacaggttatttacaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]