LOCUS       NM_001160076             986 bp    mRNA    linear   MAM 01-JUL-2020
DEFINITION  Sus scrofa claudin 7 (CLDN7), mRNA.
ACCESSION   NM_001160076
VERSION     NM_001160076.1
KEYWORDS    RefSeq.
SOURCE      Sus scrofa (pig)
  ORGANISM  Sus scrofa
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Artiodactyla; Suina; Suidae;
            Sus.
REFERENCE   1  (bases 1 to 986)
  AUTHORS   Amoozadeh Y, Dan Q, Anwer S, Huang HH, Barbieri V, Waheed F,
            Maishan M and Szaszi K.
  TITLE     Tumor Necrosis Factor-alpha Increases Claudin-1, 4, and 7
            Expression in Tubular Cells: Role in Permeability Changes
  JOURNAL   J. Cell. Physiol. 232 (8), 2210-2220 (2017)
   PUBMED   27966776
  REMARK    GeneRIF: Tumor necrosis factor-alpha increases claudin-1, 4, and 7
            expression in renal tubular cells, altering permeability and
            transepithelial electrical resistance.
REFERENCE   2  (bases 1 to 986)
  AUTHORS   Saitoh M, Kurashige Y, Nishimura M, Yamazaki M, Igarashi S, Kaku T
            and Abiko Y.
  TITLE     Expression of claudin-4 and -7 in porcine gingival junctional
            epithelium
  JOURNAL   Med Mol Morphol 42 (4), 212-215 (2009)
   PUBMED   20033366
  REMARK    GeneRIF: These findings indicate that claudin-4 and -7 may play a
            role in the gingiva junctional epithelium even in the absence of
            tight junctions.
REFERENCE   3  (bases 1 to 986)
  AUTHORS   Uenishi H, Eguchi-Ogawa T, Shinkai H, Okumura N, Suzuki K, Toki D,
            Hamasima N and Awata T.
  TITLE     PEDE (Pig EST Data Explorer) has been expanded into Pig Expression
            Data Explorer, including 10 147 porcine full-length cDNA sequences
  JOURNAL   Nucleic Acids Res. 35 (Database issue), D650-D653 (2007)
   PUBMED   17145712
REFERENCE   4  (bases 1 to 986)
  AUTHORS   Alexandre MD, Lu Q and Chen YH.
  TITLE     Overexpression of claudin-7 decreases the paracellular Cl-
            conductance and increases the paracellular Na+ conductance in
            LLC-PK1 cells
  JOURNAL   J. Cell. Sci. 118 (Pt 12), 2683-2693 (2005)
   PUBMED   15928046
  REMARK    GeneRIF: the effect of claudin-7 overexpression in LLC-PK1 cells on
            paracellular transport is mediated through a concurrent decrease in
            the paracellular conductance to Cl(-) and an increase in the
            paracellular conductance to Na(+).
REFERENCE   5  (bases 1 to 986)
  AUTHORS   Uenishi H, Eguchi T, Suzuki K, Sawazaki T, Toki D, Shinkai H,
            Okumura N, Hamasima N and Awata T.
  TITLE     PEDE (Pig EST Data Explorer): construction of a database for ESTs
            derived from porcine full-length cDNA libraries
  JOURNAL   Nucleic Acids Res. 32 (Database issue), D484-D488 (2004)
   PUBMED   14681463
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from FJ887979.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BX917121.2, BP171523.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA1965831, SAMEA1970063
                                           [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..986
                     /organism="Sus scrofa"
                     /mol_type="mRNA"
                     /db_xref="taxon:9823"
                     /chromosome="12"
                     /map="12"
     gene            1..986
                     /gene="CLDN7"
                     /note="claudin 7"
                     /db_xref="GeneID:100127486"
                     /db_xref="VGNC:VGNC:97930"
     exon            1..395
                     /gene="CLDN7"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    128..130
                     /gene="CLDN7"
                     /note="upstream in-frame stop codon"
     CDS             173..808
                     /gene="CLDN7"
                     /codon_start=1
                     /product="claudin-7 precursor"
                     /protein_id="NP_001153548.1"
                     /db_xref="GeneID:100127486"
                     /db_xref="VGNC:VGNC:97930"
                     /translation="

MANSGLQLLGFSMALLGWVGLVACTAIPQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTGMMSCKTYDSVLALSAALQATRALMVVSLVLGLMAMFVGTMGMKCTNCGGDDKVKKARIAMTGGIIFIVAGLCALIACSWYGHQIVTDFYNPLVPTNVKYEFGPAIFIGWAGSSLVLLGGALLSCSCPGSEGQSGYRAPRSYPKPNSAKEYV"

     sig_peptide     173..244
                     /gene="CLDN7"
                     /inference="COORDINATES: ab initio prediction:SignalP:4.0"
     misc_feature    182..718
                     /gene="CLDN7"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; pfam00822"
                     /db_xref="CDD:395662"
     exon            396..560
                     /gene="CLDN7"
                     /inference="alignment:Splign:2.1.0"
     exon            561..645
                     /gene="CLDN7"
                     /inference="alignment:Splign:2.1.0"
     exon            646..986
                     /gene="CLDN7"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

accctgttccctctgctgtgaggcctcttcgcccccacccccgtcccaggggtcgatttgtgtttacctcggtgactagatttgcaggcacttgaccaccaacttttttttgtctcctggactgacttaaaattcgcccacccggcgcccctcgtcttttctcagggcggaaatggccaactccggcctgcaactgctgggcttttccatggctctgctgggctgggtgggcctggtggcctgcaccgccatcccgcagtggcagatgagctcgtacgcgggggacaacatcatcacggcccaggccatgtacaaggggctatggatggactgcgtcacgcagagcacaggcatgatgagctgcaaaacgtacgactcggtgctcgccctgtccgcggccctgcaagccacccgagccctaatggtggtctccctggtgctgggtttgatggccatgttcgtgggaaccatgggcatgaagtgtacaaactgtgggggagacgacaaagtgaagaaagcccgtatagccatgactggaggcatcattttcatcgtggcaggtctttgtgcgttgatagcttgctcctggtatggccaccagattgtcacagacttttataacccgttggtccccacaaacgtgaagtatgagtttggccctgccatcttcattggctgggcagggtcctctctggtcctcctgggaggtgcgctgctctcttgctcttgtcctgggagtgagggccaatctgggtaccgtgcaccccgctcctaccctaagcccaattctgccaaggagtacgtgtgagctgggctgccctgccccagcctggcagcctatagggcaccccagacatctgaaaggacctggggcagagagctcagcccgtgggcagagtgcggagcagaagcctgcggtcactccagcctggcacactgtgtacagttcctggggggttgggaggggggaccaaaaggggagagtg

//