GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2020-11-27 00:30:19, GGRNA.v2 : RefSeq release 202 (Sep, 2020)

LOCUS       NM_001143832             969 bp    mRNA    linear   PRI 30-AUG-2020
DEFINITION  Homo sapiens leucine twenty homeobox (LEUTX), transcript variant 2,
            mRNA.
ACCESSION   NM_001143832
VERSION     NM_001143832.2
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 969)
  AUTHORS   Luck K, Kim DK, Lambourne L, Spirohn K, Begg BE, Bian W, Brignall
            R, Cafarelli T, Campos-Laborie FJ, Charloteaux B, Choi D, Cote AG,
            Daley M, Deimling S, Desbuleux A, Dricot A, Gebbia M, Hardy MF,
            Kishore N, Knapp JJ, Kovacs IA, Lemmens I, Mee MW, Mellor JC,
            Pollis C, Pons C, Richardson AD, Schlabach S, Teeking B, Yadav A,
            Babor M, Balcha D, Basha O, Bowman-Colin C, Chin SF, Choi SG,
            Colabella C, Coppin G, D'Amata C, De Ridder D, De Rouck S,
            Duran-Frigola M, Ennajdaoui H, Goebels F, Goehring L, Gopal A,
            Haddad G, Hatchi E, Helmy M, Jacob Y, Kassa Y, Landini S, Li R, van
            Lieshout N, MacWilliams A, Markey D, Paulson JN, Rangarajan S,
            Rasla J, Rayhan A, Rolland T, San-Miguel A, Shen Y, Sheykhkarimli
            D, Sheynkman GM, Simonovsky E, Tasan M, Tejeda A, Tropepe V,
            Twizere JC, Wang Y, Weatheritt RJ, Weile J, Xia Y, Yang X,
            Yeger-Lotem E, Zhong Q, Aloy P, Bader GD, De Las Rivas J, Gaudet S,
            Hao T, Rak J, Tavernier J, Hill DE, Vidal M, Roth FP and Calderwood
            MA.
  TITLE     A reference map of the human binary protein interactome
  JOURNAL   Nature 580 (7803), 402-408 (2020)
   PUBMED   32296183
REFERENCE   2  (bases 1 to 969)
  AUTHORS   Jouhilahti EM, Madissoon E, Vesterlund L, Tohonen V, Krjutskov K,
            Plaza Reyes A, Petropoulos S, Mansson R, Linnarsson S, Burglin T,
            Lanner F, Hovatta O, Katayama S and Kere J.
  TITLE     The human PRD-like homeobox gene LEUTX has a central role in embryo
            genome activation
  JOURNAL   Development 143 (19), 3459-3469 (2016)
   PUBMED   27578796
REFERENCE   3  (bases 1 to 969)
  AUTHORS   Vaquerizas JM, Kummerfeld SK, Teichmann SA and Luscombe NM.
  TITLE     A census of human transcription factors: function, expression and
            evolution
  JOURNAL   Nat. Rev. Genet. 10 (4), 252-263 (2009)
   PUBMED   19274049
  REMARK    Review article
REFERENCE   4  (bases 1 to 969)
  AUTHORS   Holland PW, Booth HA and Bruford EA.
  TITLE     Classification and nomenclature of all human homeobox genes
  JOURNAL   BMC Biol. 5, 47 (2007)
   PUBMED   17963489
  REMARK    Publication Status: Online-Only
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AC005393.1.
            On May 1, 2020 this sequence version replaced NM_001143832.1.
            
            Sequence Note:.
            
            ##Evidence-Data-START##
            Transcript exon combination :: CR746510.1, H02655.1 [ECO:0000332]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-223               AC005393.1         55550-55772
            224-375             AC005393.1         63624-63775
            376-969             AC005393.1         64795-65388
FEATURES             Location/Qualifiers
     source          1..969
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="19"
                     /map="19q13.2"
     gene            1..969
                     /gene="LEUTX"
                     /note="leucine twenty homeobox"
                     /db_xref="GeneID:342900"
                     /db_xref="HGNC:HGNC:31953"
                     /db_xref="MIM:618701"
     exon            1..223
                     /gene="LEUTX"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    94..96
                     /gene="LEUTX"
                     /note="upstream in-frame stop codon"
     exon            224..375
                     /gene="LEUTX"
                     /inference="alignment:Splign:2.1.0"
     CDS             307..813
                     /gene="LEUTX"
                     /note="isoform 2 is encoded by transcript variant 2;
                     arginine-fifty homeobox-like pseudogene; putative
                     leucine-twenty homeobox; PRD-LIKE homeobox transcription
                     factor LEUTX; paired-like homeobox transcription factor
                     LEUTX; paired-like homeodomain transcription factor LEUTX"
                     /codon_start=1
                     /product="paired-like homeodomain transcription factor
                     LEUTX isoform 2"
                     /protein_id="NP_001137304.1"
                     /db_xref="GeneID:342900"
                     /db_xref="HGNC:HGNC:31953"
                     /db_xref="MIM:618701"
                     /translation="
MHPSLATMGKLASKLQLDLSVVKIWFKNQRAKWKRQQRQQMQTRPSLGPANQTTSVKKEETPSAITTANIRPVSPGISDANDHDLREPSGIKNPGGASASARVSSWDSQSYDIEQICLGASNPPWASTLFEIDEFVKIYDLPGEDDTSSLNQYLFPVCLEYDQLQSSV"
     misc_feature    <307..408
                     /gene="LEUTX"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:278475"
     exon            376..969
                     /gene="LEUTX"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
ggagtgctgccgcaccacacagaagttctgacctggcctggggcgtatgagagaagcctttgatgagaaagtagggaatgaggcctctgaaagtaaggggagggtgtgctccaaacaaatgcaacaaaaagagaaactgtaactgcacacggttttcagcctcatgcctccgtggaacctgcctgtcaggcgggcacctggaatctcaagcaactttctcaagaagggccaaggcgttatcgtcggccacgcacaagatttctctccaaacaactcacagcattgagagaattgcttgaaaagaccatgcacccaagtttggctacaatggggaaactggcttcaaagctacaacttgatctatccgtagtaaagatctggttcaagaaccagcgtgccaaatggaagaggcagcagcggcagcaaatgcagacacggccatcactagggccagcaaaccagacaacttcagtgaagaaggaggagactccctcagccataactactgcaaacattcgtccagtaagtcctggaatctctgatgcaaatgaccatgatctacgtgagccttctggtatcaagaatcctggaggagccagcgcctctgcgagggtttcatcctgggattctcagtcatatgacattgaacagatatgtctgggggcttcaaatcctccttgggcctccactctctttgaaatagatgaatttgtaaagatctatgacttgccaggggaagatgacaccagcagcctaaatcaatatctttttccagtatgccttgagtatgaccagctccaatcttcagtgtaacttcttacacatcacttctaggggaggtctggatctgacccactgagacatatttccacacatctttaatggtttgaccccagtctaagtagatcaggggctgggaatttatctttttctgtagaaaaaacaataaaggaactcccctacctttca
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]