GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2020-04-06 11:23:16, GGRNA.v2 : RefSeq release 99 (Mar, 2020)

LOCUS       NM_001140828            1221 bp    mRNA    linear   VRT 17-APR-2013
DEFINITION  Salmo salar distal-less homeobox gene 3b (dlx3b), mRNA.
ACCESSION   NM_001140828
VERSION     NM_001140828.1
KEYWORDS    RefSeq.
SOURCE      Salmo salar (Atlantic salmon)
  ORGANISM  Salmo salar
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Protacanthopterygii;
            Salmoniformes; Salmonidae; Salmoninae; Salmo.
REFERENCE   1  (bases 1 to 1221)
  AUTHORS   Leong,J.S., Jantzen,S.G., von Schalburg,K.R., Cooper,G.A.,
            Messmer,A.M., Liao,N.Y., Munro,S., Moore,R., Holt,R.A., Jones,S.J.,
            Davidson,W.S. and Koop,B.F.
  TITLE     Salmo salar and Esox lucius full-length cDNA sequences reveal
            changes in evolutionary pressures on a post-tetraploidization
            genome
  JOURNAL   BMC Genomics 11, 279 (2010)
   PUBMED   20433749
  REMARK    Publication Status: Online-Only
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from BT047168.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BT047168.1 [ECO:0000332]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1221
                     /organism="Salmo salar"
                     /mol_type="mRNA"
                     /db_xref="taxon:8030"
     gene            1..1221
                     /gene="dlx3b"
                     /note="distal-less homeobox gene 3b"
                     /db_xref="GeneID:100195799"
     CDS             160..777
                     /gene="dlx3b"
                     /codon_start=1
                     /product="homeobox protein Dlx3b"
                     /protein_id="NP_001134300.1"
                     /db_xref="GeneID:100195799"
                     /translation="
MMSGQIYEKKIASILTDLPGSMSCHPSSKDSPTLPESSVTDMGYYSGQTAHSHHEYYQSQTYGQQMNAYHHQFNLNGMGGAGVYPTKSEYPYTNAYRQYGHYNRDHLQASPQSSVKEEPEPEVRMVNGKPKKIRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLYKNSKALGLFINKD"
     misc_feature    244..495
                     /gene="dlx3b"
                     /note="Homeobox protein distal-less-like N terminal;
                     Region: DLL_N; pfam12413"
                     /db_xref="CDD:289198"
     misc_feature    order(559..573,577..579,628..630,646..648,685..687,
                     691..696,703..708,712..720,724..729)
                     /gene="dlx3b"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    565..726
                     /gene="dlx3b"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:278475"
     misc_feature    order(565..567,574..576,694..696,703..708,715..717)
                     /gene="dlx3b"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
ORIGIN      
acaacggagttactacagctaggagagtttgaggacttgctctccaaggacttgcgtttagggcgcactactgactatatctcttcactgcgatttattttaacactactgcacaaacgttctgtatttacgaattatcgtggactttcttgtctacccatgatgagtggacagatttatgaaaagaagatagcgagcattttgaccgatctccccggatctatgagttgccatccgagctccaaggactctccgactcttccggagtcctcagtcacggacatgggttactacagtggacaaacggctcacagccatcacgaatattatcagagtcaaacatacgggcaacaaatgaatgcctaccatcaccaattcaatctgaatggaatgggtggtgcgggagtttatcccaccaagtctgaatacccttacacaaatgcctacagacaatatggacattacaacagagatcatctgcaggcttcacctcaaagctcagtgaaagaagaacccgagcctgaagttcgtatggtgaatggaaaaccaaagaaaatccgcaagccgagaacaatttactccagctaccaactagcagcgttgcagagacgttttcagaaagcgcagtacctcgccctcccggagagagccgaacttgcggctcaactcggtctgacacagacacaggtcaagatttggttccaaaaccggaggtccaaattcaagaagctttacaagaacagcaaagcgttggggctgtttattaacaaagactaaacatagagttttaatacgaggcccttccacatcaaatgaactttacagagctctaaaaagtagaagctggcgatggcttgtttttggacgtagacctgacagaagtgaaagtaggtatttccctgaaaagctgggtaaaccatttttactgtaggctagcttacctaacacgggaagaataatgacaaaactgttcagttgatccatattaaatcgtggatatgggtttgcagagcatgcgtcagaaactcaggtcataatttatatcgatttgtacaaaatgtcgaaggctgtacataggtgttaatagaaagcagaaccactaagttcatatttgtttagattggaaataccgcactgtggtgctgcgaacctttttatattaatgttgtaattagtatgttattattgcctttctgtcaaaacaaataaagatatcaattg
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]