GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2020-11-27 00:39:15, GGRNA.v2 : RefSeq release 202 (Sep, 2020)

LOCUS       NM_001140670            1115 bp    mRNA    linear   VRT 28-JUN-2020
DEFINITION  Salmo salar distal-less homeobox 5a (dlx5a), mRNA.
ACCESSION   NM_001140670
VERSION     NM_001140670.1
KEYWORDS    RefSeq.
SOURCE      Salmo salar (Atlantic salmon)
  ORGANISM  Salmo salar
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Protacanthopterygii;
            Salmoniformes; Salmonidae; Salmoninae; Salmo.
REFERENCE   1  (bases 1 to 1115)
  AUTHORS   Leong JS, Jantzen SG, von Schalburg KR, Cooper GA, Messmer AM, Liao
            NY, Munro S, Moore R, Holt RA, Jones SJ, Davidson WS and Koop BF.
  TITLE     Salmo salar and Esox lucius full-length cDNA sequences reveal
            changes in evolutionary pressures on a post-tetraploidization
            genome
  JOURNAL   BMC Genomics 11, 279 (2010)
   PUBMED   20433749
  REMARK    Publication Status: Online-Only
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from BT046548.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BT046548.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00779696, SAMN02863984
                                           [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1115
                     /organism="Salmo salar"
                     /mol_type="mRNA"
                     /db_xref="taxon:8030"
                     /chromosome="ssa27"
                     /map="ssa27"
     gene            1..1115
                     /gene="dlx5a"
                     /gene_synonym="dlx5"
                     /note="distal-less homeobox 5a"
                     /db_xref="GeneID:100195641"
     exon            1..458
                     /gene="dlx5a"
                     /gene_synonym="dlx5"
                     /inference="alignment:Splign:2.0.8"
     CDS             95..955
                     /gene="dlx5a"
                     /gene_synonym="dlx5"
                     /note="distal-less homeobox gene 5a; distal-less homeobox
                     5"
                     /codon_start=1
                     /product="homeobox protein Dlx5a"
                     /protein_id="NP_001134142.1"
                     /db_xref="GeneID:100195641"
                     /translation="
MTGVFDRRIPSIKPADFQNPFQLSTTMHHPSQESPTLPESTATDSGYYSPAGAVHHGYCSPNSTSYGKPINAYQYQYHGVNGSAGNYPAKTYPDYSAYTASAYHQYAGTYSRVQPQPLSPQEKEVAEPEVRMVNGKPKKIRKPRTIYSSFQLAALQRRFQNTQYLALPERAELAASLGLTQTQVKIWFQNKRSKLKKIMKNGELPPEHSPSSSDPMACNSPHSPAVWDTQGPSRPHSHQAQNNNSAASTFLENSASWYSAAGAMNSHLQAPNSIQHSLVLGSGTLY"
     misc_feature    188..454
                     /gene="dlx5a"
                     /gene_synonym="dlx5"
                     /note="Homeobox protein distal-less-like N terminal;
                     Region: DLL_N; pfam12413"
                     /db_xref="CDD:289198"
     misc_feature    order(515..529,533..535,584..586,602..604,641..643,
                     647..652,659..664,668..676,680..685)
                     /gene="dlx5a"
                     /gene_synonym="dlx5"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    521..682
                     /gene="dlx5a"
                     /gene_synonym="dlx5"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:278475"
     misc_feature    order(521..523,530..532,650..652,659..664,671..673)
                     /gene="dlx5a"
                     /gene_synonym="dlx5"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     exon            459..643
                     /gene="dlx5a"
                     /gene_synonym="dlx5"
                     /inference="alignment:Splign:2.0.8"
     exon            644..1115
                     /gene="dlx5a"
                     /gene_synonym="dlx5"
                     /inference="alignment:Splign:2.0.8"
ORIGIN      
aaagcacacatcacacaatgcaagtgtagtcttcactcagtcttcagacgtctcagtggaaacagacttccctttaacgttgctgcttcgaactatgactggagtattcgaccgaaggattccgagtatcaaacctgccgacttccagaacccttttcagctttccaccaccatgcatcacccgtctcaggaatctcctactctacccgagtctacggccacggattctggctactacagccctgctggagcagtgcaccatggctattgttcgcctaactccacctcgtatgggaaaccgatcaatgcctatcagtaccagtaccacggcgtaaacggatctgcgggaaattaccctgcaaaaacatacccagactacagcgcatacacagcctctgcttaccaccaatatgctggaacttatagcagagtacaaccacaaccattaagtccgcaagaaaaagaggtagcagaacctgaagtgaggatggtaaacggaaagcccaagaaaatcagaaagccaagaacaatctactccagttttcagctcgccgccctgcagcggagatttcagaacacacagtacctcgcgctgccggagagagcagagctcgcggcttcgttgggactcacgcaaacgcaggtcaaaatatggttccagaacaaaaggtcgaaactgaagaaaatcatgaagaacggcgaactcccaccggaacacagcccgagctccagcgatcccatggcttgcaactctcctcattcacccgccgtctgggacacgcagggcccgtccaggcctcacagccaccaggcacagaacaacaactcggcggcatccacctttttggaaaactccgcctcttggtactccgcggctggtgccatgaattctcacctccaggcccccaactcgatacagcactctttggttctcggatcggggacgttatactgaaacccagttcaacaaatatttcattgtatgggactcgtgtttaaaagattcagaggaatatgcaatgtattgatgacagtcatagaagaacgtgtataatgtgtaaatgtgtgcatgtaatttattgcattttggaagactaattaaacgttttaaatgg
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]