2025-09-18 08:49:53, GGRNA.v2 : RefSeq release 231 (Jul, 2025)
LOCUS NM_001113219 1675 bp mRNA linear MAM 22-JUN-2025 DEFINITION Sus scrofa MOS proto-oncogene, serine/threonine kinase (MOS), mRNA. ACCESSION NM_001113219 VERSION NM_001113219.1 KEYWORDS RefSeq. SOURCE Sus scrofa (pig) ORGANISM Sus scrofa Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Artiodactyla; Suina; Suidae; Sus. REFERENCE 1 (bases 1 to 1675) AUTHORS Nishimura,T., Shimaoka,T., Kano,K. and Naito,K. TITLE Insufficient amount of Cdc2 and continuous activation of Wee1 B are the cause of meiotic failure in porcine growing oocytes JOURNAL J Reprod Dev 55 (5), 553-557 (2009) PUBMED 19550110 REFERENCE 2 (bases 1 to 1675) AUTHORS Dai,Y., Newman,B. and Moor,R. TITLE Translational regulation of MOS messenger RNA in pig oocytes JOURNAL Biol Reprod 73 (5), 997-1003 (2005) PUBMED 15987821 REMARK GeneRIF: the length of the MOS 3'-UTR tightly controls the level of translation during oocyte maturation. two U-rich (U5A) elements and the hexanucleotide signal (AAUAAA) are required for translation. REFERENCE 3 (bases 1 to 1675) AUTHORS Ohashi,S., Naito,K., Sugiura,K., Iwamori,N., Goto,S., Naruoka,H. and Tojo,H. TITLE Analyses of mitogen-activated protein kinase function in the maturation of porcine oocytes JOURNAL Biol Reprod 68 (2), 604-609 (2003) PUBMED 12533425 REFERENCE 4 (bases 1 to 1675) AUTHORS Newman,B. and Dai,Y. TITLE Transcription of c-mos protooncogene in the pig involves both tissue-specific promoters and alternative polyadenylation sites JOURNAL Mol Reprod Dev 44 (3), 275-288 (1996) PUBMED 8858597 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from X78318.1. FEATURES Location/Qualifiers source 1..1675 /organism="Sus scrofa" /mol_type="mRNA" /db_xref="taxon:9823" /chromosome="4" /map="4" gene 1..1675 /gene="MOS" /gene_synonym="c-mos; p39-mos" /note="MOS proto-oncogene, serine/threonine kinase" /db_xref="GeneID:100127484" /db_xref="RGD:14094512" /db_xref="VGNC:VGNC:90312" exon 1..1675 /gene="MOS" /gene_synonym="c-mos; p39-mos" /inference="alignment:Splign:2.1.0" misc_feature 93..95 /gene="MOS" /gene_synonym="c-mos; p39-mos" /note="upstream in-frame stop codon" CDS 174..1211 /gene="MOS" /gene_synonym="c-mos; p39-mos" /EC_number="2.7.11.1" /note="oocyte maturation factor mos; proto-oncogene c-Mos; v-mos Moloney murine sarcoma viral oncogene homolog" /codon_start=1 /product="proto-oncogene serine/threonine-protein kinase mos" /protein_id="NP_001106690.1" /db_xref="GeneID:100127484" /db_xref="RGD:14094512" /db_xref="VGNC:VGNC:90312" /translation="
MPSPFPRRRCLPGDFSPSVDSRPCSSPCELPGPTGKLFLGGTPPRALRLPRRLAWCSIDWEQVCLLQRLGAGGFGSVYKATYHGVPVAIKQVSRCTKNRLASQRSFWAELNIARLRHANIVRVVAASTRTPAAFDSLGSIIMEFGGNVTLHQVIYGATGCPEEDGPPCSAGEQLNLEKCLKYSLDVVSGLLFLHSQGIVHLDLKPANILISEQDVCKISDFGCSERLEDLRFRPRHHLGGTYTHRAPELLKGEPVTPKADIYSFAITLWQMTTRQVPYSGERQHVLYAVVAYNLRPSLSAAVFTESVPGKKLEDIIQCGWTAPAQQRPSAQLLLLDLRALQAELG"
misc_feature 348..1160 /gene="MOS" /gene_synonym="c-mos; p39-mos" /note="Catalytic domain of the Serine/Threonine kinase, Oocyte maturation factor Mos; Region: STKc_Mos; cd13979" /db_xref="CDD:270881" misc_feature order(378..392,402..404,435..437,441..443,534..536, 597..608,618..620,624..626,777..779,783..785,789..794, 798..800,831..833,840..842,891..902) /gene="MOS" /gene_synonym="c-mos; p39-mos" /note="active site" /db_xref="CDD:270881" misc_feature order(378..392,402..404,435..437,441..443,534..536, 597..608,618..620,777..779,783..785,789..794,798..800, 831..833) /gene="MOS" /gene_synonym="c-mos; p39-mos" /note="ATP binding site [chemical binding]; other site" /db_xref="CDD:270881" misc_feature order(390..392,618..620,624..626,777..779,783..785, 789..791,840..842,891..902) /gene="MOS" /gene_synonym="c-mos; p39-mos" /note="polypeptide substrate binding site [polypeptide binding]; other site" /db_xref="CDD:270881" misc_feature order(828..869,882..902) /gene="MOS" /gene_synonym="c-mos; p39-mos" /note="activation loop (A-loop); other site" /db_xref="CDD:270881" ORIGIN
cgctgagtaacagcacagatgtggctcatctgcggaagatggaggcagaggagaaaagcgctgggccggggcgcggagcggcaggtggtcagtgatgcttgcacgcccgcccgctgggtcttctcttccctcctatcccacccaagccgcggcgggctgccctccgcagggcgatgccctcacctttccctcggcgccggtgcctgcctggcgacttctccccgtcggtggactcgcggccctgcagcagcccctgcgagctcccggggccgacagggaagctcttcctggggggcaccccaccccgggccctgcgccttcctcgccggctggcctggtgctcaatagactgggaacaggtgtgcctgctgcagcggctgggagccgggggcttcggctcggtatacaaggccacctaccacggcgtgcctgtggccatcaaacaggtgagcagatgcaccaagaaccggctggcatcccagcgcagtttctgggccgagctcaacatcgctcggctccgccacgccaatatcgtgcgcgtggtggccgccagcacgcgcacacccgcggcctttgacagcctgggcagcatcatcatggagttcggcggcaacgtcaccttacaccaggtcatctacggcgctacgggctgtccagaggaggatgggcctccctgcagtgctggggagcaactgaacttggagaagtgtctcaagtattccctggatgtggtcagtggcctgcttttcctgcactcccaaggcattgtgcacttggacctgaagccagcgaacattctgatcagtgagcaggacgtctgcaaaatcagcgactttggttgctccgagaggctggaagatctgcgcttccggcctcggcaccacctgggcggcacgtacacccaccgagcccccgagctcctcaaaggcgagcccgtcaccccaaaagcggacatctactcctttgccatcaccctctggcagatgaccactaggcaggtgccttactcaggggagcgtcagcacgtgctctacgcggtggtggcctacaatctccgtccgtccctctcggcggcggtcttcaccgagtccgtccctgggaagaaactggaggacatcatccagtgcggctggacggcccctgcgcagcagcggcccagcgcacaactcctcctgctggaccttcgcgctctacaagctgaactgggctgacccgaaacgtgtggccggataagcatttgtctttgttgctgttcatttttaacaagagaagatgtaggcaaaaaaaaaaaaacaaaaacaaaaacaaaaaacatagaggtaggatggatttttagaaaataaagttaccaaaaactcctttcaccccaaatgcttttcctaagacaaacagcagaactagaaatctagtggtgtctctccttctccctttacagagctctgtgtttgcttcagagctactgtgcttccttgcagttccatagtactgcacttaactcaaatttgttattggtctgttaacagtttacttgctcccgtacaaataagctaaaaaacaaagattaatttttccctcctgctcttcccccaaaactacttgtttctaatgatcttcacacatacagttcgcaagttgaggtaagcttgtttttaaaaggaatgatactttaaatgat
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]