2024-04-20 16:00:04, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001109884 2068 bp mRNA linear ROD 22-MAR-2023 DEFINITION Rattus norvegicus homeo box C4 (Hoxc4), mRNA. ACCESSION NM_001109884 XM_235703 VERSION NM_001109884.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 2068) AUTHORS Schmidt JA, Avarbock MR, Tobias JW and Brinster RL. TITLE Identification of glial cell line-derived neurotrophic factor-regulated genes important for spermatogonial stem cell self-renewal in the rat JOURNAL Biol Reprod 81 (1), 56-66 (2009) PUBMED 19339709 REFERENCE 2 (bases 1 to 2068) AUTHORS Calonge WM, Martinez L, Lacadena J, Fernandez-Dumont V, Matesanz R and Tovar JA. TITLE Expression of homeotic genes Hoxa3, Hoxb3, Hoxd3 and Hoxc4 is decreased in the lungs but not in the hearts of adriamycin-exposed mice JOURNAL Pediatr Surg Int 23 (5), 419-424 (2007) PUBMED 17211587 REFERENCE 3 (bases 1 to 2068) AUTHORS Wissmuller S, Kosian T, Wolf M, Finzsch M and Wegner M. TITLE The high-mobility-group domain of Sox proteins interacts with DNA-binding domains of many transcription factors JOURNAL Nucleic Acids Res 34 (6), 1735-1744 (2006) PUBMED 16582099 REMARK Publication Status: Online-Only REFERENCE 4 (bases 1 to 2068) AUTHORS Kim EC, Edmonston CR, Wu X, Schaffer A and Casali P. TITLE The HoxC4 homeodomain protein mediates activation of the immunoglobulin heavy chain 3' hs1,2 enhancer in human B cells. Relevance to class switch DNA recombination JOURNAL J Biol Chem 279 (40), 42258-42269 (2004) PUBMED 15252056 REFERENCE 5 (bases 1 to 2068) AUTHORS Boulet AM and Capecchi MR. TITLE Targeted disruption of hoxc-4 causes esophageal defects and vertebral transformations JOURNAL Dev Biol 177 (1), 232-249 (1996) PUBMED 8660891 REFERENCE 6 (bases 1 to 2068) AUTHORS Saegusa H, Takahashi N, Noguchi S and Suemori H. TITLE Targeted disruption in the mouse Hoxc-4 locus results in axial skeleton homeosis and malformation of the xiphoid process JOURNAL Dev Biol 174 (1), 55-64 (1996) PUBMED 8626021 REFERENCE 7 (bases 1 to 2068) AUTHORS Chung SY, Dai PH, Lei J, Riviere M, Levan G, Szpirer J and Szpirer C. TITLE Chromosomal assignment of seven rat homeobox genes to rat chromosomes 3, 4, 7, and 10 JOURNAL Mamm Genome 4 (9), 537-540 (1993) PUBMED 7906969 REFERENCE 8 (bases 1 to 2068) AUTHORS Falzon M and Chung SY. TITLE The expression of rat homeobox-containing genes is developmentally regulated and tissue specific JOURNAL Development 103 (3), 601-610 (1988) PUBMED 2907739 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from JACYVU010000187.1. On Oct 10, 2007 this sequence version replaced XM_235703.3. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. ##Evidence-Data-START## Transcript exon combination :: FN802484.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMD00132261, SAMD00132262 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on conservation, expression, longest protein ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-866 JACYVU010000187.1 20905090-20905955 867-2068 JACYVU010000187.1 20906431-20907632 FEATURES Location/Qualifiers source 1..2068 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN" /db_xref="taxon:10116" /chromosome="7" /map="7q36" gene 1..2068 /gene="Hoxc4" /gene_synonym="Hox3r3" /note="homeo box C4" /db_xref="GeneID:24459" /db_xref="RGD:1586210" exon 1..866 /gene="Hoxc4" /gene_synonym="Hox3r3" /inference="alignment:Splign:2.1.0" misc_feature 356..358 /gene="Hoxc4" /gene_synonym="Hox3r3" /note="upstream in-frame stop codon" CDS 428..1222 /gene="Hoxc4" /gene_synonym="Hox3r3" /note="homeobox protein R3; Homeobox gene C4" /codon_start=1 /product="homeobox protein Hox-C4" /protein_id="NP_001103354.1" /db_xref="GeneID:24459" /db_xref="RGD:1586210" /translation="
MIMSSYLMDSNYIDPKFPPCEEYSQNSYIPEHSPEYYGRTRESGFQHHHQELYPPPPPRPSYPERQYSCTSLQGPGNSRAHGPAQAGHHHPEKSQPLCEPAPLSGASASPSPAPPACSQPAPDHPSSAASKQPIVYPWMKKIHVSTVNPNYNGGEPKRSRTAYTRQQVLELEKEFHYNRYLTRRRRIEIAHSLCLSERQIKIWFQNRRMKWKKDHRLPNTKVRSAPPAGAAPSTLSAATPGTSEDHSQSATPPEQQRAEDITRL"
misc_feature order(896..910,914..916,965..967,983..985,1022..1024, 1028..1033,1040..1045,1049..1057,1061..1066) /gene="Hoxc4" /gene_synonym="Hox3r3" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 902..1063 /gene="Hoxc4" /gene_synonym="Hox3r3" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature order(902..904,911..913,1031..1033,1040..1045,1052..1054) /gene="Hoxc4" /gene_synonym="Hox3r3" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 867..2068 /gene="Hoxc4" /gene_synonym="Hox3r3" /inference="alignment:Splign:2.1.0" ORIGIN
tggaaaggcactggagccgaggcccaccgggtccactgaaggccggagaggagactctgggtgggggctgaatcacagcctaccaacagcccccaatgcccagacattggagtcgagctgggagccacccatcttctgcaagggaggattgtcagtctggtggggtgtgcaatggtgagcaccccagcttctgccagccatccccccaccccaccccctcagcagcagcagcaccacacacacaaaaaattggatacattttgaataaagcgattcggttccttatccggggactgagttgctcggtgtgattggccggcggagtcacatggtgaaagtaactttacagggtcgctagctagtaggagggctttatggagcagaaaaacgacaaagcgagaaaaattattttccactccagaaattaatgatcatgagctcgtatttgatggactctaactacatcgatccgaaatttcctccatgcgaagaatattcgcaaaatagctacatccctgaacacagtccggaatattacggccggaccagggaatcgggattccagcatcaccaccaggagctgtacccaccaccgcctccgcgccctagctaccctgagcgtcagtatagctgcaccagtctccaggggcccggcaattcgcgagcccacgggccggcccaggcgggccaccaccaccctgagaaatcgcagccgctctgcgagccggcgcctctctcaggcgcctctgcctccccgtccccagccccgccagcctgcagccagccagcccctgaccatccctccagcgccgccagcaagcagcccatagtctacccttggatgaaaaaaattcacgttagcacggtgaaccccaattataacggaggggagcccaagcgctcgaggacagcctacacccggcagcaggtcctggaattagagaaagagtttcattacaaccgctacctgacccgaaggagaaggatcgagatcgcccactcgctgtgcctctctgagaggcagatcaaaatctggttccaaaaccgtcgcatgaaatggaagaaggaccaccgactccccaacaccaaagtgaggtcagcgcccccggccggcgctgcacccagcaccctctcggcagccacccccggcacttctgaagaccactcccagagcgccacgccgccggagcagcaacgggcagaggacatcaccaggttataagacataacttacacccctgcccccaccctgtgctccgtgccccctcacacacaaattgactcttatttatagaatttaatatatatatatttttggttctttttttctctctcttcctcctgtctcctcccttgtcagttccaaacagacaaaacagataaacaaacaagccccttgcccttttccctttgctgttaaggacccctttaagcatgtggtgttgtcttagcatggtacctgctgggttttattttttgttgttttgttttgttttgctttgctttgcttttaaggccattggggggtatttattttttaaggaaaaaaagctgcaaaaattatatattgcaaggtgtgatggtctggtttgggtgaatttcaggggaaatgaggaacagaaaaaggaaagggagatttgtaagtggattctcatcctctctcctcctcaccccccctccctttccttaggccttttgcattgaaaatgcaccaggggaggttagtgaggggggggagtcattttaaggagaacaaagctatgaagttcttttgtattcttgtgggggggtggtaggaggggggaggacagcaaacaaagctaaatgcatctggagagcctctgggagctgttcagtttgaggagccaaaaaataaataaataaataaaaatgaactttcagttcagagaggcagtctataggtagatgctcccctacccccatcgtggttattgtgtttttggactgaatttacttgattattgtaaaacttgcaataaagaattttagtgttgatgtgaaatgcccccgtgatcaataataaaccagtggctgtgaattagtttta
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]