GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-05 01:44:50, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001107931            4016 bp    mRNA    linear   ROD 15-JUL-2023
DEFINITION  Rattus norvegicus caveolae associated protein 4 (Cavin4), mRNA.
ACCESSION   NM_001107931 XM_001055709 XM_232981
VERSION     NM_001107931.3
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 4016)
  AUTHORS   Malette J, Degrandmaison J, Giguere H, Berthiaume J, Frappier M,
            Parent JL, Auger-Messier M and Boulay G.
  TITLE     MURC/CAVIN-4 facilitates store-operated calcium entry in neonatal
            cardiomyocytes
  JOURNAL   Biochim Biophys Acta Mol Cell Res 1866 (8), 1249-1259 (2019)
   PUBMED   30951783
  REMARK    GeneRIF: study provides novel evidence that MURC regulates SOCE by
            interacting with STIM1 in cardiomyocytes. In addition, we
            identified a first potential mechanism by which the R140W mutation
            of MURC may contribute to calcium mishandling and the development
            of cardiomyopathies.
REFERENCE   2  (bases 1 to 4016)
  AUTHORS   Naito D, Ogata T, Hamaoka T, Nakanishi N, Miyagawa K, Maruyama N,
            Kasahara T, Taniguchi T, Nishi M, Matoba S and Ueyama T.
  TITLE     The coiled-coil domain of MURC/cavin-4 is involved in membrane
            trafficking of caveolin-3 in cardiomyocytes
  JOURNAL   Am J Physiol Heart Circ Physiol 309 (12), H2127-H2136 (2015)
   PUBMED   26497963
  REMARK    GeneRIF: MURC/cavin-4 requires its coiled-coil domain to target the
            plasma membrane and to stabilize Cav3 at the plasma membrane of
            cardiomyocytes
REFERENCE   3  (bases 1 to 4016)
  AUTHORS   Ogata T, Naito D, Nakanishi N, Hayashi YK, Taniguchi T, Miyagawa K,
            Hamaoka T, Maruyama N, Matoba S, Ikeda K, Yamada H, Oh H and Ueyama
            T.
  TITLE     MURC/Cavin-4 facilitates recruitment of ERK to caveolae and
            concentric cardiac hypertrophy induced by alpha1-adrenergic
            receptors
  JOURNAL   Proc Natl Acad Sci U S A 111 (10), 3811-3816 (2014)
   PUBMED   24567387
REFERENCE   4  (bases 1 to 4016)
  AUTHORS   Rodriguez G, Ueyama T, Ogata T, Czernuszewicz G, Tan Y, Dorn GW
            2nd, Bogaev R, Amano K, Oh H, Matsubara H, Willerson JT and Marian
            AJ.
  TITLE     Molecular genetic and functional characterization implicate
            muscle-restricted coiled-coil gene (MURC) as a causal gene for
            familial dilated cardiomyopathy
  JOURNAL   Circ Cardiovasc Genet 4 (4), 349-358 (2011)
   PUBMED   21642240
REFERENCE   5  (bases 1 to 4016)
  AUTHORS   Hansen CG, Bright NA, Howard G and Nichols BJ.
  TITLE     SDPR induces membrane curvature and functions in the formation of
            caveolae
  JOURNAL   Nat Cell Biol 11 (7), 807-814 (2009)
   PUBMED   19525939
REFERENCE   6  (bases 1 to 4016)
  AUTHORS   Ogata T, Ueyama T, Isodono K, Tagawa M, Takehara N, Kawashima T,
            Harada K, Takahashi T, Shioi T, Matsubara H and Oh H.
  TITLE     MURC, a muscle-restricted coiled-coil protein that modulates the
            Rho/ROCK pathway, induces cardiac dysfunction and conduction
            disturbance
  JOURNAL   Mol Cell Biol 28 (10), 3424-3436 (2008)
   PUBMED   18332105
  REMARK    GeneRIF: MURC modulates RhoA signaling, and MURC plays an important
            role in the development of cardiac dysfunction and conduction
            disturbance with increased vulnerability to atrial arrhythmias.
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            JACYVU010000161.1.
            
            On Aug 30, 2022 this sequence version replaced NM_001107931.2.
            
            ##Evidence-Data-START##
            Transcript exon combination :: SRR8487230.73354.1, EU487255.1
                                           [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA5760383, SAMEA5760384
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-477               JACYVU010000161.1  38421035-38421511
            478-4016            JACYVU010000161.1  38428268-38431806
FEATURES             Location/Qualifiers
     source          1..4016
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN"
                     /db_xref="taxon:10116"
                     /chromosome="5"
                     /map="5q22"
     gene            1..4016
                     /gene="Cavin4"
                     /gene_synonym="RGD1310395"
                     /note="caveolae associated protein 4"
                     /db_xref="GeneID:313225"
                     /db_xref="RGD:1310395"
     exon            1..477
                     /gene="Cavin4"
                     /gene_synonym="RGD1310395"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    22..24
                     /gene="Cavin4"
                     /gene_synonym="RGD1310395"
                     /note="upstream in-frame stop codon"
     CDS             70..1158
                     /gene="Cavin4"
                     /gene_synonym="RGD1310395"
                     /note="muscle-related coiled-coil protein;
                     muscle-restricted coiled-coil protein"
                     /codon_start=1
                     /product="caveolae-associated protein 4"
                     /protein_id="NP_001101401.1"
                     /db_xref="GeneID:313225"
                     /db_xref="RGD:1310395"
                     /translation="
MEHNGSASNAGKIHQNRLSSVTEDEDQDAALTIVTVLDRVATVVDSVQASQKRIEERHREMGNAIKSVQIDLLKLSQSHSNTGYVVNKLFEKTRKVSAHIKDVKARVEKQQVRVTKVETKQEEIMKKNKFRVVIFQEDVPCPASLSVVKDRSLPENEEEAEEVFDPPIDLSSDEEYYVEESRSARLRKSGKEHIDHIKKAFSKENMQKTRQNFDKKVSGIRTRIVTPERRERLRQSGERLRQSGERLRQSGERFKKSISNATPSKEAFKIRSLRKPKDPKAEGQEVDRGMGVDIISGSLALGPIHEFHSDGFSETEKEVTKVGYIPQEGGDPPTPEPLKVTFKPQVRVEDDESLLLELKQSS"
     misc_feature    70..141
                     /gene="Cavin4"
                     /gene_synonym="RGD1310395"
                     /note="propagated from UniProtKB/Swiss-Prot (B1PRL5.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    148..858
                     /gene="Cavin4"
                     /gene_synonym="RGD1310395"
                     /note="PTRF/SDPR family; Region: PTRF_SDPR; pfam15237"
                     /db_xref="CDD:434559"
     misc_feature    523..525
                     /gene="Cavin4"
                     /gene_synonym="RGD1310395"
                     /note="Phosphoserine.
                     /evidence=ECO:0007744|PubMed:22673903; propagated from
                     UniProtKB/Swiss-Prot (B1PRL5.1); phosphorylation site"
     misc_feature    580..582
                     /gene="Cavin4"
                     /gene_synonym="RGD1310395"
                     /note="Phosphoserine.
                     /evidence=ECO:0007744|PubMed:22673903; propagated from
                     UniProtKB/Swiss-Prot (B1PRL5.1); phosphorylation site"
     misc_feature    583..585
                     /gene="Cavin4"
                     /gene_synonym="RGD1310395"
                     /note="Phosphoserine.
                     /evidence=ECO:0007744|PubMed:22673903; propagated from
                     UniProtKB/Swiss-Prot (B1PRL5.1); phosphorylation site"
     misc_feature    748..852
                     /gene="Cavin4"
                     /gene_synonym="RGD1310395"
                     /note="propagated from UniProtKB/Swiss-Prot (B1PRL5.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    1039..1041
                     /gene="Cavin4"
                     /gene_synonym="RGD1310395"
                     /note="Phosphotyrosine.
                     /evidence=ECO:0000250|UniProtKB:A2AMM0; propagated from
                     UniProtKB/Swiss-Prot (B1PRL5.1); phosphorylation site"
     misc_feature    1069..1071
                     /gene="Cavin4"
                     /gene_synonym="RGD1310395"
                     /note="Phosphothreonine.
                     /evidence=ECO:0007744|PubMed:22673903; propagated from
                     UniProtKB/Swiss-Prot (B1PRL5.1); phosphorylation site"
     misc_feature    1126..1128
                     /gene="Cavin4"
                     /gene_synonym="RGD1310395"
                     /note="Phosphoserine.
                     /evidence=ECO:0000250|UniProtKB:A2AMM0; propagated from
                     UniProtKB/Swiss-Prot (B1PRL5.1); phosphorylation site"
     exon            478..4016
                     /gene="Cavin4"
                     /gene_synonym="RGD1310395"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
gccgacttttggctccgagtgtaggagccgatcgctgtaggacatcttctgctgagaaaaaaaagtaaaatggaacacaatggatctgcttcaaatgctggtaaaatccaccagaaccgattgtcaagtgtgactgaagatgaagaccaggacgcagctctcacaattgtgactgtgctggacagggtggccaccgtcgtggacagcgtgcaggcaagccagaagagaatcgaggagagacacagagagatggggaacgccatcaagtctgtccagatagacctgctgaagctctcacaatcacacagcaacacgggctacgttgttaacaagctgtttgagaagacccggaaagtcagcgctcacattaaagatgtgaaggcccgggtagagaagcaacaggttcgagtaaccaaagtcgaaaccaagcaagaagaaataatgaagaagaacaagttccgcgtggtaatcttccaggaggatgttccctgccccgcatccctgtctgttgttaaagacagaagcctgccggagaacgaggaggaagctgaggaagtcttcgatcccccgatcgatctctcatcggatgaagaatactatgttgaagaaagcagatctgccaggcttagaaagtcaggcaaagagcacatcgatcatattaagaaggcattttccaaagaaaacatgcagaagacgcggcagaattttgataagaaagtgagtggaattagaaccaggatagttacacctgagagaagagagaggctgaggcagtcaggagagaggctgaggcagtcgggggagaggctgaggcagtcgggggaaagatttaagaaatcgatctcaaatgccaccccctccaaggaagcttttaagatccggagccttagaaaaccgaaggaccccaaggcggaaggccaggaggtagacagggggatgggggtggacatcatctcaggtagcctggctctggggcccatccatgagttccactctgatgggttcagtgaaacagaaaaggaggtgaccaaagtagggtacattccccaagagggaggggaccccccaacgcctgagcctttgaaggtgacctttaaacctcaggtgagagtagaggatgacgagtcactcctgttggaattaaagcagtcctcatagaggacttgagtgtgagcatcagtcacttcgaatcatgtggtcgtagtttgaagggtacagtaatttacattcatgcacagtgggaaggcaaatggtataaaagcttcatttcttacctttaaaatcctagagatgatggaaatattatatacagttttcttataatttccttgggaattctatttcccctgagaatatatgactctgacagcttccccctcatccccgcttatgtcatgcctttccatgggaggtcttggccaatgagaaaatagtcggatggctcaggtcacttagatgcttggtcatttgtaacacgggaacgacacatctgtgcccattggtcaccaacaaagcatacattagggtcaggattaacacttccagtttcaaaggggagtagctaatgtgtacattgtgttatccagatgtttacatctggagattcattagtgaatcagtagccttatgaagctcctgaagtccttgtgtgagggaaaggaaatagaagtttggggcctgaacgtttagctgtggcaacgtaactttattactagtgagacacttggctggctgcccctcgttctcaataggaaaaatggtgaggcttcgtacttctcagaggacttgagatctgagggtatgtcacagagtgtgggagaacaagacacacaaccagtggagaagcgtgaaccacactggccttccctaaaccagaactgaacagttacatctctgcagaagcccttggcacaggctctgaggccagagttgagcagaaactgagtttgttcttcacaagtcttcactgcacgcacagtgaaaaatgaacgcttggatgggtgctttctcattgaaggctgagaccaaaccttgggttttagccgtgtcctaacatgttccttggaagactggctccatttgccggtagatttggatgtggggtagacaagtacaggtcttgtttgcccagcacgaggtagaagtctggaacacggttgtcaagtggcttttccacggtccgccctggtgtgccgctgggcacagaaacaaccccgacacttctgtttgccagagcggactgagaacagtgcccataagctttcgtcagggccacgcggagggcgtccaattccagttagctcttagatctagatctgggtagtcaagaggtaactattgctgcttccagcacacggaaatcttgggggcattttcttgatatggaagagatggtagaatttttgataagttcgtttaaactcacatttagtttaatttttgaataatcatgtagtacttaaatatatgcaggcttgggggtgcgtgcctgctgccccagcactagcaaggctgaaacaggatcgcagtgaagctgagtgagcctgggctccctttatatacacagttcagtatactttccttttctcttggcctgaatacgtgttcatcttgctatctcttttttatttgtttgttttctttcctcctcctccttctcttctttggtttgtttgtttgcttgcttgtttgtgttttcaagatggggtttctctgtgtagtcctggaacttgctctgtggaccaggctggcctcttaactcacagagacccgcttgccccccctcccgagggctgggtttaaaggggtgtaacaccatcacacggcatcctgctaccttttttatactgcaaactaaagcatgtgtagcattgaataacactttaagagaataattccaaacacattttttttataacagcttagaaggaggttaacggtgtctaagaataagtttgaatgtgaaatgatgttgttgcaaaatgcgaggccggtgttgtggttgttaatcttttaaccagtgatgagtggtaactgcaatatgcaaatggagaaagagttaaccaatggtaaatcaaggctcgagggaatacagagaagttacagacgtggtacgtcgagggcaggaggaatgtcgagaagttacagttgttgttttcagtttatttcatttggtctaaaatacttttctgcaaatgtctagggctttgtccactagtcattaatgtccggctctgacagcttagaaagcattgcacctgtagccatattagagtctgactgggaaggagttacgacctggccagccagctctttgtcttgctagagtttgacaccagaaccaccggatgtttcctgttgctgaccgctcatgtaatcccatgcttccttctcaccgtcagggtttcccctccatgttgtgaacatgtgtcctttcatgtttaggacattcctgaattccacattcacagtctcttgtacctcctacctgctttcatggctcggagatgatgggctgcaaaagtcactcactctcttaacacaagggcacaagggacgttctagtcagtgttcatcagtttaaaagtctcgggaaatgcccggttgcttgctgatctgtaatgcagcattacgcatcaggctttagataatttacccaaggcaaaccttcagcaggatttgcccccttctagtaatgagatggagcagagcagctgccccagaggccaggggtggggacgctggtgttgaggcttttccaggggacacagtgaagtgaaagcctgtctcctgtgtgtggtgatccagctatcctgagtggccagtggcttggcccctgcttacaggttatagagaaatgaactcgggtgttccgcttgccgacagtggacttgtgtgtgttcccccaaaagcaagttttcatgagtgaaaagtacaagctgccaaagtaaaaagccaaccatattgccttccttctttgcctttcatattcattaaagatgtcagtttggaacagg
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]