LOCUS       NM_001107931            4016 bp    mRNA    linear   ROD 01-MAY-2025
DEFINITION  Rattus norvegicus caveolae associated protein 4 (Cavin4), mRNA.
ACCESSION   NM_001107931 XM_001055709 XM_232981
VERSION     NM_001107931.3
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 4016)
  AUTHORS   Malette,J., Degrandmaison,J., Giguere,H., Berthiaume,J.,
            Frappier,M., Parent,J.L., Auger-Messier,M. and Boulay,G.
  TITLE     MURC/CAVIN-4 facilitates store-operated calcium entry in neonatal
            cardiomyocytes
  JOURNAL   Biochim Biophys Acta Mol Cell Res 1866 (8), 1249-1259 (2019)
   PUBMED   30951783
  REMARK    GeneRIF: study provides novel evidence that MURC regulates SOCE by
            interacting with STIM1 in cardiomyocytes. In addition, we
            identified a first potential mechanism by which the R140W mutation
            of MURC may contribute to calcium mishandling and the development
            of cardiomyopathies.
REFERENCE   2  (bases 1 to 4016)
  AUTHORS   Naito,D., Ogata,T., Hamaoka,T., Nakanishi,N., Miyagawa,K.,
            Maruyama,N., Kasahara,T., Taniguchi,T., Nishi,M., Matoba,S. and
            Ueyama,T.
  TITLE     The coiled-coil domain of MURC/cavin-4 is involved in membrane
            trafficking of caveolin-3 in cardiomyocytes
  JOURNAL   Am J Physiol Heart Circ Physiol 309 (12), H2127-H2136 (2015)
   PUBMED   26497963
  REMARK    GeneRIF: MURC/cavin-4 requires its coiled-coil domain to target the
            plasma membrane and to stabilize Cav3 at the plasma membrane of
            cardiomyocytes
REFERENCE   3  (bases 1 to 4016)
  AUTHORS   Ogata,T., Naito,D., Nakanishi,N., Hayashi,Y.K., Taniguchi,T.,
            Miyagawa,K., Hamaoka,T., Maruyama,N., Matoba,S., Ikeda,K.,
            Yamada,H., Oh,H. and Ueyama,T.
  TITLE     MURC/Cavin-4 facilitates recruitment of ERK to caveolae and
            concentric cardiac hypertrophy induced by alpha1-adrenergic
            receptors
  JOURNAL   Proc Natl Acad Sci U S A 111 (10), 3811-3816 (2014)
   PUBMED   24567387
REFERENCE   4  (bases 1 to 4016)
  AUTHORS   Rodriguez,G., Ueyama,T., Ogata,T., Czernuszewicz,G., Tan,Y.,
            Dorn,G.W. 2nd, Bogaev,R., Amano,K., Oh,H., Matsubara,H.,
            Willerson,J.T. and Marian,A.J.
  TITLE     Molecular genetic and functional characterization implicate
            muscle-restricted coiled-coil gene (MURC) as a causal gene for
            familial dilated cardiomyopathy
  JOURNAL   Circ Cardiovasc Genet 4 (4), 349-358 (2011)
   PUBMED   21642240
REFERENCE   5  (bases 1 to 4016)
  AUTHORS   Hansen,C.G., Bright,N.A., Howard,G. and Nichols,B.J.
  TITLE     SDPR induces membrane curvature and functions in the formation of
            caveolae
  JOURNAL   Nat Cell Biol 11 (7), 807-814 (2009)
   PUBMED   19525939
REFERENCE   6  (bases 1 to 4016)
  AUTHORS   Ogata,T., Ueyama,T., Isodono,K., Tagawa,M., Takehara,N.,
            Kawashima,T., Harada,K., Takahashi,T., Shioi,T., Matsubara,H. and
            Oh,H.
  TITLE     MURC, a muscle-restricted coiled-coil protein that modulates the
            Rho/ROCK pathway, induces cardiac dysfunction and conduction
            disturbance
  JOURNAL   Mol Cell Biol 28 (10), 3424-3436 (2008)
   PUBMED   18332105
  REMARK    GeneRIF: MURC modulates RhoA signaling, and MURC plays an important
            role in the development of cardiac dysfunction and conduction
            disturbance with increased vulnerability to atrial arrhythmias.
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            JAXUCZ010000005.1.
            
            On Aug 30, 2022 this sequence version replaced NM_001107931.2.
            
            ##Evidence-Data-START##
            Transcript exon combination :: SRR26643296.15183.1,
                                           SRR26643295.21275.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA5760383, SAMEA5760386
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on conservation, expression,
                                      longest protein
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-477               JAXUCZ010000005.1  67792432-67792908
            478-4016            JAXUCZ010000005.1  67799665-67803203
FEATURES             Location/Qualifiers
     source          1..4016
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN"
                     /db_xref="taxon:10116"
                     /chromosome="5"
                     /map="5q22"
     gene            1..4016
                     /gene="Cavin4"
                     /gene_synonym="RGD1310395"
                     /note="caveolae associated protein 4"
                     /db_xref="GeneID:313225"
                     /db_xref="RGD:1310395"
     exon            1..477
                     /gene="Cavin4"
                     /gene_synonym="RGD1310395"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    22..24
                     /gene="Cavin4"
                     /gene_synonym="RGD1310395"
                     /note="upstream in-frame stop codon"
     CDS             70..1158
                     /gene="Cavin4"
                     /gene_synonym="RGD1310395"
                     /note="muscle-related coiled-coil protein;
                     muscle-restricted coiled-coil protein"
                     /codon_start=1
                     /product="caveolae-associated protein 4"
                     /protein_id="NP_001101401.1"
                     /db_xref="GeneID:313225"
                     /db_xref="RGD:1310395"
                     /translation="

MEHNGSASNAGKIHQNRLSSVTEDEDQDAALTIVTVLDRVATVVDSVQASQKRIEERHREMGNAIKSVQIDLLKLSQSHSNTGYVVNKLFEKTRKVSAHIKDVKARVEKQQVRVTKVETKQEEIMKKNKFRVVIFQEDVPCPASLSVVKDRSLPENEEEAEEVFDPPIDLSSDEEYYVEESRSARLRKSGKEHIDHIKKAFSKENMQKTRQNFDKKVSGIRTRIVTPERRERLRQSGERLRQSGERLRQSGERFKKSISNATPSKEAFKIRSLRKPKDPKAEGQEVDRGMGVDIISGSLALGPIHEFHSDGFSETEKEVTKVGYIPQEGGDPPTPEPLKVTFKPQVRVEDDESLLLELKQSS"

     misc_feature    70..141
                     /gene="Cavin4"
                     /gene_synonym="RGD1310395"
                     /note="propagated from UniProtKB/Swiss-Prot (B1PRL5.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    148..858
                     /gene="Cavin4"
                     /gene_synonym="RGD1310395"
                     /note="PTRF/SDPR family; Region: PTRF_SDPR; pfam15237"
                     /db_xref="CDD:464578"
     misc_feature    523..525
                     /gene="Cavin4"
                     /gene_synonym="RGD1310395"
                     /note="Phosphoserine.
                     /evidence=ECO:0007744|PubMed:22673903; propagated from
                     UniProtKB/Swiss-Prot (B1PRL5.1); phosphorylation site"
     misc_feature    580..582
                     /gene="Cavin4"
                     /gene_synonym="RGD1310395"
                     /note="Phosphoserine.
                     /evidence=ECO:0007744|PubMed:22673903; propagated from
                     UniProtKB/Swiss-Prot (B1PRL5.1); phosphorylation site"
     misc_feature    583..585
                     /gene="Cavin4"
                     /gene_synonym="RGD1310395"
                     /note="Phosphoserine.
                     /evidence=ECO:0007744|PubMed:22673903; propagated from
                     UniProtKB/Swiss-Prot (B1PRL5.1); phosphorylation site"
     misc_feature    748..852
                     /gene="Cavin4"
                     /gene_synonym="RGD1310395"
                     /note="propagated from UniProtKB/Swiss-Prot (B1PRL5.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    1039..1041
                     /gene="Cavin4"
                     /gene_synonym="RGD1310395"
                     /note="Phosphotyrosine.
                     /evidence=ECO:0000250|UniProtKB:A2AMM0; propagated from
                     UniProtKB/Swiss-Prot (B1PRL5.1); phosphorylation site"
     misc_feature    1069..1071
                     /gene="Cavin4"
                     /gene_synonym="RGD1310395"
                     /note="Phosphothreonine.
                     /evidence=ECO:0007744|PubMed:22673903; propagated from
                     UniProtKB/Swiss-Prot (B1PRL5.1); phosphorylation site"
     misc_feature    1126..1128
                     /gene="Cavin4"
                     /gene_synonym="RGD1310395"
                     /note="Phosphoserine.
                     /evidence=ECO:0000250|UniProtKB:A2AMM0; propagated from
                     UniProtKB/Swiss-Prot (B1PRL5.1); phosphorylation site"
     exon            478..4016
                     /gene="Cavin4"
                     /gene_synonym="RGD1310395"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

gccgacttttggctccgagtgtaggagccgatcgctgtaggacatcttctgctgagaaaaaaaagtaaaatggaacacaatggatctgcttcaaatgctggtaaaatccaccagaaccgattgtcaagtgtgactgaagatgaagaccaggacgcagctctcacaattgtgactgtgctggacagggtggccaccgtcgtggacagcgtgcaggcaagccagaagagaatcgaggagagacacagagagatggggaacgccatcaagtctgtccagatagacctgctgaagctctcacaatcacacagcaacacgggctacgttgttaacaagctgtttgagaagacccggaaagtcagcgctcacattaaagatgtgaaggcccgggtagagaagcaacaggttcgagtaaccaaagtcgaaaccaagcaagaagaaataatgaagaagaacaagttccgcgtggtaatcttccaggaggatgttccctgccccgcatccctgtctgttgttaaagacagaagcctgccggagaacgaggaggaagctgaggaagtcttcgatcccccgatcgatctctcatcggatgaagaatactatgttgaagaaagcagatctgccaggcttagaaagtcaggcaaagagcacatcgatcatattaagaaggcattttccaaagaaaacatgcagaagacgcggcagaattttgataagaaagtgagtggaattagaaccaggatagttacacctgagagaagagagaggctgaggcagtcaggagagaggctgaggcagtcgggggagaggctgaggcagtcgggggaaagatttaagaaatcgatctcaaatgccaccccctccaaggaagcttttaagatccggagccttagaaaaccgaaggaccccaaggcggaaggccaggaggtagacagggggatgggggtggacatcatctcaggtagcctggctctggggcccatccatgagttccactctgatgggttcagtgaaacagaaaaggaggtgaccaaagtagggtacattccccaagagggaggggaccccccaacgcctgagcctttgaaggtgacctttaaacctcaggtgagagtagaggatgacgagtcactcctgttggaattaaagcagtcctcatagaggacttgagtgtgagcatcagtcacttcgaatcatgtggtcgtagtttgaagggtacagtaatttacattcatgcacagtgggaaggcaaatggtataaaagcttcatttcttacctttaaaatcctagagatgatggaaatattatatacagttttcttataatttccttgggaattctatttcccctgagaatatatgactctgacagcttccccctcatccccgcttatgtcatgcctttccatgggaggtcttggccaatgagaaaatagtcggatggctcaggtcacttagatgcttggtcatttgtaacacgggaacgacacatctgtgcccattggtcaccaacaaagcatacattagggtcaggattaacacttccagtttcaaaggggagtagctaatgtgtacattgtgttatccagatgtttacatctggagattcattagtgaatcagtagccttatgaagctcctgaagtccttgtgtgagggaaaggaaatagaagtttggggcctgaacgtttagctgtggcaacgtaactttattactagtgagacacttggctggctgcccctcgttctcaataggaaaaatggtgaggcttcgtacttctcagaggacttgagatctgagggtatgtcacagagtgtgggagaacaagacacacaaccagtggagaagcgtgaaccacactggccttccctaaaccagaactgaacagttacatctctgcagaagcccttggcacaggctctgaggccagagttgagcagaaactgagtttgttcttcacaagtcttcactgcacgcacagtgaaaaatgaacgcttggatgggtgctttctcattgaaggctgagaccaaaccttgggttttagccgtgtcctaacatgttccttggaagactggctccatttgccggtagatttggatgtggggtagacaagtacaggtcttgtttgcccagcacgaggtagaagtctggaacacggttgtcaagtggcttttccacggtccgccctggtgtgccgctgggcacagaaacaaccccgacacttctgtttgccagagcggactgagaacagtgcccataagctttcgtcagggccacgcggagggcgtccaattccagttagctcttagatctagatctgggtagtcaagaggtaactattgctgcttccagcacacggaaatcttgggggcattttcttgatatggaagagatggtagaatttttgataagttcgtttaaactcacatttagtttaatttttgaataatcatgtagtacttaaatatatgcaggcttgggggtgcgtgcctgctgccccagcactagcaaggctgaaacaggatcgcagtgaagctgagtgagcctgggctccctttatatacacagttcagtatactttccttttctcttggcctgaatacgtgttcatcttgctatctcttttttatttgtttgttttctttcctcctcctccttctcttctttggtttgtttgtttgcttgcttgtttgtgttttcaagatggggtttctctgtgtagtcctggaacttgctctgtggaccaggctggcctcttaactcacagagacccgcttgccccccctcccgagggctgggtttaaaggggtgtaacaccatcacacggcatcctgctaccttttttatactgcaaactaaagcatgtgtagcattgaataacactttaagagaataattccaaacacattttttttataacagcttagaaggaggttaacggtgtctaagaataagtttgaatgtgaaatgatgttgttgcaaaatgcgaggccggtgttgtggttgttaatcttttaaccagtgatgagtggtaactgcaatatgcaaatggagaaagagttaaccaatggtaaatcaaggctcgagggaatacagagaagttacagacgtggtacgtcgagggcaggaggaatgtcgagaagttacagttgttgttttcagtttatttcatttggtctaaaatacttttctgcaaatgtctagggctttgtccactagtcattaatgtccggctctgacagcttagaaagcattgcacctgtagccatattagagtctgactgggaaggagttacgacctggccagccagctctttgtcttgctagagtttgacaccagaaccaccggatgtttcctgttgctgaccgctcatgtaatcccatgcttccttctcaccgtcagggtttcccctccatgttgtgaacatgtgtcctttcatgtttaggacattcctgaattccacattcacagtctcttgtacctcctacctgctttcatggctcggagatgatgggctgcaaaagtcactcactctcttaacacaagggcacaagggacgttctagtcagtgttcatcagtttaaaagtctcgggaaatgcccggttgcttgctgatctgtaatgcagcattacgcatcaggctttagataatttacccaaggcaaaccttcagcaggatttgcccccttctagtaatgagatggagcagagcagctgccccagaggccaggggtggggacgctggtgttgaggcttttccaggggacacagtgaagtgaaagcctgtctcctgtgtgtggtgatccagctatcctgagtggccagtggcttggcccctgcttacaggttatagagaaatgaactcgggtgttccgcttgccgacagtggacttgtgtgtgttcccccaaaagcaagttttcatgagtgaaaagtacaagctgccaaagtaaaaagccaaccatattgccttccttctttgcctttcatattcattaaagatgtcagtttggaacagg

//