2024-10-23 02:06:00, GGRNA.v2 : RefSeq release 226 (Sep, 2024)
LOCUS NM_001107931 4016 bp mRNA linear ROD 02-APR-2024 DEFINITION Rattus norvegicus caveolae associated protein 4 (Cavin4), mRNA. ACCESSION NM_001107931 XM_001055709 XM_232981 VERSION NM_001107931.3 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 4016) AUTHORS Malette,J., Degrandmaison,J., Giguere,H., Berthiaume,J., Frappier,M., Parent,J.L., Auger-Messier,M. and Boulay,G. TITLE MURC/CAVIN-4 facilitates store-operated calcium entry in neonatal cardiomyocytes JOURNAL Biochim Biophys Acta Mol Cell Res 1866 (8), 1249-1259 (2019) PUBMED 30951783 REMARK GeneRIF: study provides novel evidence that MURC regulates SOCE by interacting with STIM1 in cardiomyocytes. In addition, we identified a first potential mechanism by which the R140W mutation of MURC may contribute to calcium mishandling and the development of cardiomyopathies. REFERENCE 2 (bases 1 to 4016) AUTHORS Naito,D., Ogata,T., Hamaoka,T., Nakanishi,N., Miyagawa,K., Maruyama,N., Kasahara,T., Taniguchi,T., Nishi,M., Matoba,S. and Ueyama,T. TITLE The coiled-coil domain of MURC/cavin-4 is involved in membrane trafficking of caveolin-3 in cardiomyocytes JOURNAL Am J Physiol Heart Circ Physiol 309 (12), H2127-H2136 (2015) PUBMED 26497963 REMARK GeneRIF: MURC/cavin-4 requires its coiled-coil domain to target the plasma membrane and to stabilize Cav3 at the plasma membrane of cardiomyocytes REFERENCE 3 (bases 1 to 4016) AUTHORS Ogata,T., Naito,D., Nakanishi,N., Hayashi,Y.K., Taniguchi,T., Miyagawa,K., Hamaoka,T., Maruyama,N., Matoba,S., Ikeda,K., Yamada,H., Oh,H. and Ueyama,T. TITLE MURC/Cavin-4 facilitates recruitment of ERK to caveolae and concentric cardiac hypertrophy induced by alpha1-adrenergic receptors JOURNAL Proc Natl Acad Sci U S A 111 (10), 3811-3816 (2014) PUBMED 24567387 REFERENCE 4 (bases 1 to 4016) AUTHORS Rodriguez,G., Ueyama,T., Ogata,T., Czernuszewicz,G., Tan,Y., Dorn,G.W. 2nd, Bogaev,R., Amano,K., Oh,H., Matsubara,H., Willerson,J.T. and Marian,A.J. TITLE Molecular genetic and functional characterization implicate muscle-restricted coiled-coil gene (MURC) as a causal gene for familial dilated cardiomyopathy JOURNAL Circ Cardiovasc Genet 4 (4), 349-358 (2011) PUBMED 21642240 REFERENCE 5 (bases 1 to 4016) AUTHORS Hansen,C.G., Bright,N.A., Howard,G. and Nichols,B.J. TITLE SDPR induces membrane curvature and functions in the formation of caveolae JOURNAL Nat Cell Biol 11 (7), 807-814 (2009) PUBMED 19525939 REFERENCE 6 (bases 1 to 4016) AUTHORS Ogata,T., Ueyama,T., Isodono,K., Tagawa,M., Takehara,N., Kawashima,T., Harada,K., Takahashi,T., Shioi,T., Matsubara,H. and Oh,H. TITLE MURC, a muscle-restricted coiled-coil protein that modulates the Rho/ROCK pathway, induces cardiac dysfunction and conduction disturbance JOURNAL Mol Cell Biol 28 (10), 3424-3436 (2008) PUBMED 18332105 REMARK GeneRIF: MURC modulates RhoA signaling, and MURC plays an important role in the development of cardiac dysfunction and conduction disturbance with increased vulnerability to atrial arrhythmias. COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JAXUCZ010000005.1. On Aug 30, 2022 this sequence version replaced NM_001107931.2. ##Evidence-Data-START## Transcript exon combination :: SRR26643296.15183.1, SRR26643295.21275.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA5760383, SAMEA5760386 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on conservation, expression, longest protein ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-477 JAXUCZ010000005.1 67792432-67792908 478-4016 JAXUCZ010000005.1 67799665-67803203 FEATURES Location/Qualifiers source 1..4016 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN" /db_xref="taxon:10116" /chromosome="5" /map="5q22" gene 1..4016 /gene="Cavin4" /gene_synonym="RGD1310395" /note="caveolae associated protein 4" /db_xref="GeneID:313225" /db_xref="RGD:1310395" exon 1..477 /gene="Cavin4" /gene_synonym="RGD1310395" /inference="alignment:Splign:2.1.0" misc_feature 22..24 /gene="Cavin4" /gene_synonym="RGD1310395" /note="upstream in-frame stop codon" CDS 70..1158 /gene="Cavin4" /gene_synonym="RGD1310395" /note="muscle-related coiled-coil protein; muscle-restricted coiled-coil protein" /codon_start=1 /product="caveolae-associated protein 4" /protein_id="NP_001101401.1" /db_xref="GeneID:313225" /db_xref="RGD:1310395" /translation="
MEHNGSASNAGKIHQNRLSSVTEDEDQDAALTIVTVLDRVATVVDSVQASQKRIEERHREMGNAIKSVQIDLLKLSQSHSNTGYVVNKLFEKTRKVSAHIKDVKARVEKQQVRVTKVETKQEEIMKKNKFRVVIFQEDVPCPASLSVVKDRSLPENEEEAEEVFDPPIDLSSDEEYYVEESRSARLRKSGKEHIDHIKKAFSKENMQKTRQNFDKKVSGIRTRIVTPERRERLRQSGERLRQSGERLRQSGERFKKSISNATPSKEAFKIRSLRKPKDPKAEGQEVDRGMGVDIISGSLALGPIHEFHSDGFSETEKEVTKVGYIPQEGGDPPTPEPLKVTFKPQVRVEDDESLLLELKQSS"
misc_feature 70..141 /gene="Cavin4" /gene_synonym="RGD1310395" /note="propagated from UniProtKB/Swiss-Prot (B1PRL5.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 148..858 /gene="Cavin4" /gene_synonym="RGD1310395" /note="PTRF/SDPR family; Region: PTRF_SDPR; pfam15237" /db_xref="CDD:464578" misc_feature 523..525 /gene="Cavin4" /gene_synonym="RGD1310395" /note="Phosphoserine. /evidence=ECO:0007744|PubMed:22673903; propagated from UniProtKB/Swiss-Prot (B1PRL5.1); phosphorylation site" misc_feature 580..582 /gene="Cavin4" /gene_synonym="RGD1310395" /note="Phosphoserine. /evidence=ECO:0007744|PubMed:22673903; propagated from UniProtKB/Swiss-Prot (B1PRL5.1); phosphorylation site" misc_feature 583..585 /gene="Cavin4" /gene_synonym="RGD1310395" /note="Phosphoserine. /evidence=ECO:0007744|PubMed:22673903; propagated from UniProtKB/Swiss-Prot (B1PRL5.1); phosphorylation site" misc_feature 748..852 /gene="Cavin4" /gene_synonym="RGD1310395" /note="propagated from UniProtKB/Swiss-Prot (B1PRL5.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 1039..1041 /gene="Cavin4" /gene_synonym="RGD1310395" /note="Phosphotyrosine. /evidence=ECO:0000250|UniProtKB:A2AMM0; propagated from UniProtKB/Swiss-Prot (B1PRL5.1); phosphorylation site" misc_feature 1069..1071 /gene="Cavin4" /gene_synonym="RGD1310395" /note="Phosphothreonine. /evidence=ECO:0007744|PubMed:22673903; propagated from UniProtKB/Swiss-Prot (B1PRL5.1); phosphorylation site" misc_feature 1126..1128 /gene="Cavin4" /gene_synonym="RGD1310395" /note="Phosphoserine. /evidence=ECO:0000250|UniProtKB:A2AMM0; propagated from UniProtKB/Swiss-Prot (B1PRL5.1); phosphorylation site" exon 478..4016 /gene="Cavin4" /gene_synonym="RGD1310395" /inference="alignment:Splign:2.1.0" ORIGIN
gccgacttttggctccgagtgtaggagccgatcgctgtaggacatcttctgctgagaaaaaaaagtaaaatggaacacaatggatctgcttcaaatgctggtaaaatccaccagaaccgattgtcaagtgtgactgaagatgaagaccaggacgcagctctcacaattgtgactgtgctggacagggtggccaccgtcgtggacagcgtgcaggcaagccagaagagaatcgaggagagacacagagagatggggaacgccatcaagtctgtccagatagacctgctgaagctctcacaatcacacagcaacacgggctacgttgttaacaagctgtttgagaagacccggaaagtcagcgctcacattaaagatgtgaaggcccgggtagagaagcaacaggttcgagtaaccaaagtcgaaaccaagcaagaagaaataatgaagaagaacaagttccgcgtggtaatcttccaggaggatgttccctgccccgcatccctgtctgttgttaaagacagaagcctgccggagaacgaggaggaagctgaggaagtcttcgatcccccgatcgatctctcatcggatgaagaatactatgttgaagaaagcagatctgccaggcttagaaagtcaggcaaagagcacatcgatcatattaagaaggcattttccaaagaaaacatgcagaagacgcggcagaattttgataagaaagtgagtggaattagaaccaggatagttacacctgagagaagagagaggctgaggcagtcaggagagaggctgaggcagtcgggggagaggctgaggcagtcgggggaaagatttaagaaatcgatctcaaatgccaccccctccaaggaagcttttaagatccggagccttagaaaaccgaaggaccccaaggcggaaggccaggaggtagacagggggatgggggtggacatcatctcaggtagcctggctctggggcccatccatgagttccactctgatgggttcagtgaaacagaaaaggaggtgaccaaagtagggtacattccccaagagggaggggaccccccaacgcctgagcctttgaaggtgacctttaaacctcaggtgagagtagaggatgacgagtcactcctgttggaattaaagcagtcctcatagaggacttgagtgtgagcatcagtcacttcgaatcatgtggtcgtagtttgaagggtacagtaatttacattcatgcacagtgggaaggcaaatggtataaaagcttcatttcttacctttaaaatcctagagatgatggaaatattatatacagttttcttataatttccttgggaattctatttcccctgagaatatatgactctgacagcttccccctcatccccgcttatgtcatgcctttccatgggaggtcttggccaatgagaaaatagtcggatggctcaggtcacttagatgcttggtcatttgtaacacgggaacgacacatctgtgcccattggtcaccaacaaagcatacattagggtcaggattaacacttccagtttcaaaggggagtagctaatgtgtacattgtgttatccagatgtttacatctggagattcattagtgaatcagtagccttatgaagctcctgaagtccttgtgtgagggaaaggaaatagaagtttggggcctgaacgtttagctgtggcaacgtaactttattactagtgagacacttggctggctgcccctcgttctcaataggaaaaatggtgaggcttcgtacttctcagaggacttgagatctgagggtatgtcacagagtgtgggagaacaagacacacaaccagtggagaagcgtgaaccacactggccttccctaaaccagaactgaacagttacatctctgcagaagcccttggcacaggctctgaggccagagttgagcagaaactgagtttgttcttcacaagtcttcactgcacgcacagtgaaaaatgaacgcttggatgggtgctttctcattgaaggctgagaccaaaccttgggttttagccgtgtcctaacatgttccttggaagactggctccatttgccggtagatttggatgtggggtagacaagtacaggtcttgtttgcccagcacgaggtagaagtctggaacacggttgtcaagtggcttttccacggtccgccctggtgtgccgctgggcacagaaacaaccccgacacttctgtttgccagagcggactgagaacagtgcccataagctttcgtcagggccacgcggagggcgtccaattccagttagctcttagatctagatctgggtagtcaagaggtaactattgctgcttccagcacacggaaatcttgggggcattttcttgatatggaagagatggtagaatttttgataagttcgtttaaactcacatttagtttaatttttgaataatcatgtagtacttaaatatatgcaggcttgggggtgcgtgcctgctgccccagcactagcaaggctgaaacaggatcgcagtgaagctgagtgagcctgggctccctttatatacacagttcagtatactttccttttctcttggcctgaatacgtgttcatcttgctatctcttttttatttgtttgttttctttcctcctcctccttctcttctttggtttgtttgtttgcttgcttgtttgtgttttcaagatggggtttctctgtgtagtcctggaacttgctctgtggaccaggctggcctcttaactcacagagacccgcttgccccccctcccgagggctgggtttaaaggggtgtaacaccatcacacggcatcctgctaccttttttatactgcaaactaaagcatgtgtagcattgaataacactttaagagaataattccaaacacattttttttataacagcttagaaggaggttaacggtgtctaagaataagtttgaatgtgaaatgatgttgttgcaaaatgcgaggccggtgttgtggttgttaatcttttaaccagtgatgagtggtaactgcaatatgcaaatggagaaagagttaaccaatggtaaatcaaggctcgagggaatacagagaagttacagacgtggtacgtcgagggcaggaggaatgtcgagaagttacagttgttgttttcagtttatttcatttggtctaaaatacttttctgcaaatgtctagggctttgtccactagtcattaatgtccggctctgacagcttagaaagcattgcacctgtagccatattagagtctgactgggaaggagttacgacctggccagccagctctttgtcttgctagagtttgacaccagaaccaccggatgtttcctgttgctgaccgctcatgtaatcccatgcttccttctcaccgtcagggtttcccctccatgttgtgaacatgtgtcctttcatgtttaggacattcctgaattccacattcacagtctcttgtacctcctacctgctttcatggctcggagatgatgggctgcaaaagtcactcactctcttaacacaagggcacaagggacgttctagtcagtgttcatcagtttaaaagtctcgggaaatgcccggttgcttgctgatctgtaatgcagcattacgcatcaggctttagataatttacccaaggcaaaccttcagcaggatttgcccccttctagtaatgagatggagcagagcagctgccccagaggccaggggtggggacgctggtgttgaggcttttccaggggacacagtgaagtgaaagcctgtctcctgtgtgtggtgatccagctatcctgagtggccagtggcttggcccctgcttacaggttatagagaaatgaactcgggtgttccgcttgccgacagtggacttgtgtgtgttcccccaaaagcaagttttcatgagtgaaaagtacaagctgccaaagtaaaaagccaaccatattgccttccttctttgcctttcatattcattaaagatgtcagtttggaacagg
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]