LOCUS       NM_001105979            2342 bp    mRNA    linear   ROD 20-MAR-2023
DEFINITION  Rattus norvegicus Mix paired-like homeobox 1 (Mixl1), mRNA.
ACCESSION   NM_001105979 XM_001061956 XM_222997
VERSION     NM_001105979.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 2342)
  AUTHORS   Pereira LA, Wong MS, Mossman AK, Sourris K, Janes ME, Knezevic K,
            Hirst CE, Lim SM, Pimanda JE, Stanley EG and Elefanty AG.
  TITLE     Pdgfralpha and Flk1 are direct target genes of Mixl1 in
            differentiating embryonic stem cells
  JOURNAL   Stem Cell Res 8 (2), 165-179 (2012)
   PUBMED   22265737
REFERENCE   2  (bases 1 to 2342)
  AUTHORS   Pereira LA, Wong MS, Lim SM, Sides A, Stanley EG and Elefanty AG.
  TITLE     Brachyury and related Tbx proteins interact with the Mixl1
            homeodomain protein and negatively regulate Mixl1 transcriptional
            activity
  JOURNAL   PLoS One 6 (12), e28394 (2011)
   PUBMED   22164283
REFERENCE   3  (bases 1 to 2342)
  AUTHORS   Zhang H, Fraser ST, Papazoglu C, Hoatlin ME and Baron MH.
  TITLE     Transcriptional activation by the Mixl1 homeodomain protein in
            differentiating mouse embryonic stem cells
  JOURNAL   Stem Cells 27 (12), 2884-2895 (2009)
   PUBMED   19711456
REFERENCE   4  (bases 1 to 2342)
  AUTHORS   Lim SM, Pereira L, Wong MS, Hirst CE, Van Vranken BE, Pick M,
            Trounson A, Elefanty AG and Stanley EG.
  TITLE     Enforced expression of Mixl1 during mouse ES cell differentiation
            suppresses hematopoietic mesoderm and promotes endoderm formation
  JOURNAL   Stem Cells 27 (2), 363-374 (2009)
   PUBMED   19038793
REFERENCE   5  (bases 1 to 2342)
  AUTHORS   Tam PP, Khoo PL, Lewis SL, Bildsoe H, Wong N, Tsang TE, Gad JM and
            Robb L.
  TITLE     Sequential allocation and global pattern of movement of the
            definitive endoderm in the mouse embryo during gastrulation
  JOURNAL   Development 134 (2), 251-260 (2007)
   PUBMED   17151016
REFERENCE   6  (bases 1 to 2342)
  AUTHORS   Willey S, Ayuso-Sacido A, Zhang H, Fraser ST, Sahr KE, Adlam MJ,
            Kyba M, Daley GQ, Keller G and Baron MH.
  TITLE     Acceleration of mesoderm development and expansion of hematopoietic
            progenitors in differentiating ES cells by the mouse Mix-like
            homeodomain transcription factor
  JOURNAL   Blood 107 (8), 3122-3130 (2006)
   PUBMED   16403910
REFERENCE   7  (bases 1 to 2342)
  AUTHORS   Mohn D, Chen SW, Dias DC, Weinstein DC, Dyer MA, Sahr K, Ducker CE,
            Zahradka E, Keller G, Zaret KS, Gudas LJ and Baron MH.
  TITLE     Mouse Mix gene is activated early during differentiation of ES and
            F9 stem cells and induces endoderm in frog embryos
  JOURNAL   Dev Dyn 226 (3), 446-459 (2003)
   PUBMED   12619131
REFERENCE   8  (bases 1 to 2342)
  AUTHORS   Hart AH, Hartley L, Sourris K, Stadler ES, Li R, Stanley EG, Tam
            PP, Elefanty AG and Robb L.
  TITLE     Mixl1 is required for axial mesendoderm morphogenesis and
            patterning in the murine embryo
  JOURNAL   Development 129 (15), 3597-3608 (2002)
   PUBMED   12117810
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from CH473985.1.
            
            On or before Oct 3, 2007 this sequence version replaced
            XM_001061956.1, XM_222997.3.
            
            ##Evidence-Data-START##
            RNAseq introns :: single sample supports all introns SAMEA5760434
                              [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..2342
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="13"
                     /map="13q26"
     gene            1..2342
                     /gene="Mixl1"
                     /note="Mix paired-like homeobox 1"
                     /db_xref="GeneID:289311"
                     /db_xref="RGD:1310011"
     exon            1..415
                     /gene="Mixl1"
                     /inference="alignment:Splign:2.1.0"
     CDS             23..718
                     /gene="Mixl1"
                     /codon_start=1
                     /product="homeobox protein MIXL1"
                     /protein_id="NP_001099449.1"
                     /db_xref="GeneID:289311"
                     /db_xref="RGD:1310011"
                     /translation="

MAAAGSQQLQFAEGAAFPTFPAAHPGGQLLPAARPATGLPPAPPDSRAPAATPCFPSRGPRPAAQTPTGLDPPGPSKGSAAPSAPQRRKRTSFSSEQLQLLELVFRQTMYPDIHLRERLAALTLLPESRIQVWFQNRRAKSRRQSGKSFQPLSSRREDFLHRPAPGTEARCLKPQLPLEADVNHVLDSSMAGGGVCTSGSQGFETYSSLSEDIGSKLDSWEEHIFSALGSF"

     misc_feature    <26..439
                     /gene="Mixl1"
                     /note="DNA polymerase III subunit gamma/tau; Region:
                     PRK14971"
                     /db_xref="CDD:237874"
     misc_feature    278..448
                     /gene="Mixl1"
                     /note="Homeodomain; Region: HOX; smart00389"
                     /db_xref="CDD:197696"
     misc_feature    order(281..295,299..301,350..352,368..370,407..409,
                     413..418,425..430,434..442,446..451)
                     /gene="Mixl1"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(287..289,296..298,416..418,425..430,437..439)
                     /gene="Mixl1"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     exon            416..2342
                     /gene="Mixl1"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

tcccgggaaacgtcccggagtgatggccgcagcagggtcccagcagcttcagttcgcagagggcgccgctttccccaccttcccggccgcgcaccccggaggacagctgctcccggccgcgcgcccagccactgggctacccccggcgcccccggactctcgcgccccagcggccacgccatgctttccaagccggggccccaggcccgcagcgcagactcccaccggcctggatccgcccggaccctccaaaggctcggccgccccgtctgcgccgcagcgccgcaagcgcacgtcgttcagctccgagcagctgcagttgctggagctcgtcttccgacagaccatgtaccccgacatccacttgcgggagcgtctggctgcgctcacgctgctacccgagtcaaggatccaggtgtggttccagaacagacgggccaagtcccggcgtcagagcgggaagtcgtttcagcccttatcctcaaggcgggaagatttcctccatcgtcctgctccggggactgaagcaaggtgtctgaagcctcagttgcctctagaggcggatgtgaaccacgttctggattccagtatggctggaggaggcgtctgtacatctggttctcagggttttgaaacttactcctctctctctgaagatattggctcaaagttggactcatgggaggagcacatcttttctgccttgggtagcttctgaggattctgggagagttcaagatgtactcagggagatctgggagattcgaaccagaccctgtctgatctcctgactggccaggtcttggttctggatcacctctcatatttaggtttcccttctccgacacagcctttactgctggcttgttcttggtagccacccgccctcccacccgcaagtcactgtgaatctccaagactgcacattatcatcggtctacatcccctgggccttctcactagggttattctcgttttccagactgattattcaaaatttgctttcctcataggaacctccagctggattcaatttctcccctttctcggcagctgcctacaacgtgggttcactctctctcacccaaatccttatcaccaagacttagtactttttattgaatctttttgttttgtttttgaccttgctgtgtaagtaaggatggcatgaactcctgtcctcccacctctatttgccatcgtgactgactggatgttgctatttttgcttaaaattgtgtatgatattaagatatatatccaaatcaagcttaacacatgcatgagatcagtcaccttccttttttctgcgatgatacaatctattagcaatttcaagtatatgaaatatcgatactaactctagccattaccattgagttcttcagcttctctctcctagctgactgagtatcctagccacctcccctgccctcacttgactggtttctcgtctggcctgtcaactttacactccatcagtaaagatgctactttcaacctctttcaagaaccccatgcctcttgttccccactttctttctttctttttcttttttttttttggttctttttttttttcggagctggggactgaacccagggccttgcgcttcctaggtaagcgctctaccactgagctaaatccccagcccctctttctttcttttttaaattactctatttggaaatctgtggcagcatccagttaccaaaccataagaccctgtcaagcacgctcctagtcaatgacatcatctttagcttatgcaaactttaagatcatttacccacaatgtgcttctctgtctgtctctgtctgtcattcctttctagttgggactcagtgagaaagcttctctttcaaaacagctcaagcacaccgctttctgaagcctgaacttttcttaactaatcctgtttttcgtacctgttactttgatgaccatttttcttagcacttgttcttattatgtttcctgtacaacattagtggattactaaatgctcctcactgccgttttttacatgaatcccattgaaatgagccctgttttcccagacctcagcactgggaaagttggggaatacataatgaatgacagaaaacattctgaagggaactttctgcacacacagtacatcgagaatttatttgagcacgcttatctgctgggctgctgagatagctcagtggaggtaaacatgttgtcaccaagcatgacaatctgagtttgatccccaagacccacatggtgagaaggagaatggatttgtcttttagacttccacatgtgtgctatggtgtatacccacatacatacacacatacaaaataaata

//