GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-27 14:23:58, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001090914             882 bp    mRNA    linear   VRT 24-MAY-2021
DEFINITION  Xenopus laevis paired like homeobox 2B L homeolog (phox2b.L), mRNA.
ACCESSION   NM_001090914 NM_001090915
VERSION     NM_001090914.1
KEYWORDS    RefSeq.
SOURCE      Xenopus laevis (African clawed frog)
  ORGANISM  Xenopus laevis
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae;
            Xenopus; Xenopus.
REFERENCE   1  (bases 1 to 882)
  AUTHORS   Talikka M, Stefani G, Brivanlou AH and Zimmerman K.
  TITLE     Characterization of Xenopus Phox2a and Phox2b defines expression
            domains within the embryonic nervous system and early heart field
  JOURNAL   Gene Expr. Patterns 4 (5), 601-607 (2004)
   PUBMED   15261839
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AY371498.1.
            
            On Jul 25, 2007 this sequence version replaced NM_001090915.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AY371498.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN04111052, SAMN04111062
                                           [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..882
                     /organism="Xenopus laevis"
                     /mol_type="mRNA"
                     /db_xref="taxon:8355"
                     /chromosome="1L"
     gene            1..882
                     /gene="phox2b.L"
                     /gene_synonym="phox2; phox2b; xphox2b"
                     /note="paired like homeobox 2B L homeolog"
                     /db_xref="GeneID:402787"
                     /db_xref="Xenbase:XB-GENE-17342593"
     CDS             1..882
                     /gene="phox2b.L"
                     /gene_synonym="phox2; phox2b; xphox2b"
                     /note="paired-like homeobox 2b"
                     /codon_start=1
                     /product="paired like homeobox 2B L homeolog"
                     /protein_id="NP_001084383.1"
                     /db_xref="GeneID:402787"
                     /db_xref="Xenbase:XB-GENE-17342593"
                     /translation="
MYKMEYSYLNSSAYESCMAGMDTSSLASAYADFSSCSQASGFQYNPIRTTFGATSGCPSLTPGSCSLGTLRDHQSSPYAAVPYKLFTDHGGLNEKRKQRRIRTTFTSAQLKELERVFAETHYPDIYTREELALKIDLTEARVQVWFQNRRAKFRKQERAAAAAAAAAKNGSSGKKSDSSRDEESKDSKSADPDSTGGPVNNPNPTPSCGGGPSPSGVQGNVVPQEPGKVGMQGPGSLASASVVGVTGGPQGWATGPGGTITSIPDSLGGPFASVLSSLQRPNSTKATLVKSMF"
     misc_feature    283..477
                     /gene="phox2b.L"
                     /gene_synonym="phox2; phox2b; xphox2b"
                     /note="Region: homeodomain"
     misc_feature    order(295..309,313..315,364..366,382..384,421..423,
                     427..432,439..444,448..456,460..465)
                     /gene="phox2b.L"
                     /gene_synonym="phox2; phox2b; xphox2b"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(301..303,310..312,430..432,439..444,451..453)
                     /gene="phox2b.L"
                     /gene_synonym="phox2; phox2b; xphox2b"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    304..462
                     /gene="phox2b.L"
                     /gene_synonym="phox2; phox2b; xphox2b"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
     exon            1..241
                     /gene="phox2b.L"
                     /gene_synonym="phox2; phox2b; xphox2b"
                     /inference="alignment:Splign:2.0.8"
     exon            242..429
                     /gene="phox2b.L"
                     /gene_synonym="phox2; phox2b; xphox2b"
                     /inference="alignment:Splign:2.0.8"
     exon            430..882
                     /gene="phox2b.L"
                     /gene_synonym="phox2; phox2b; xphox2b"
                     /inference="alignment:Splign:2.0.8"
ORIGIN      
atgtataaaatggaatattcttacctcaattcctccgcctatgagtcgtgcatggctggcatggacacttctagcctggcctcagcctatgccgatttcagctcgtgcagccaagccagtggcttccagtataatcctatcaggaccacttttggggccacttcaggttgcccgtccctcaccccaggatcctgcagcctcggcactctcagagaccatcagagcagcccctatgcagcagttccttacaagctattcactgatcacggtgggctgaatgagaagaggaaacagagaagaatacgcacaaccttcaccagcgcgcagcttaaggaactagagagagtattcgcagagacccattaccctgatatctacacccgcgaggaactggcgctcaagatagacctgactgaagccagagtgcaggtctggttccagaaccgcagggccaagttcaggaagcaggaaagagcagcagcagcggcagcagcagcagccaaaaatggctcctcgggcaagaaatccgactcctcgcgggacgaagagagcaaggactccaagagtgccgaccctgacagcaccggggggcccgtgaataatccgaaccccactcccagctgtggtggagggccaagtcctagcggggtacagggaaatgtggtcccacaggagccaggcaaggtcggaatgcaggggcctggaagcctggcatcagcatcagttgtaggagtcacaggtggaccacaaggctgggcaactgggccaggaggcaccatcacctctatccctgactccttaggaggcccctttgccagtgtcttatcttctctgcagagacccaacagcaccaaagccactctagtcaaaagcatgttctga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]