GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2020-03-31 05:28:41, GGRNA.v2 : RefSeq release 99 (Mar, 2020)

LOCUS       NM_001089976            2376 bp    mRNA    linear   VRT 28-OCT-2016
DEFINITION  Xenopus laevis claudin 5 (transmembrane protein deleted in
            velocardiofacial syndrome) L homeolog (cldn5.L), mRNA.
ACCESSION   NM_001089976 NM_001089977
VERSION     NM_001089976.1
KEYWORDS    RefSeq.
SOURCE      Xenopus laevis (African clawed frog)
  ORGANISM  Xenopus laevis
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae;
            Xenopus; Xenopus.
REFERENCE   1  (bases 1 to 2376)
  AUTHORS   Zhao L, Wang P, Liu Y, Ma J and Xue Y.
  TITLE     miR-34c regulates the permeability of blood-tumor barrier via
            MAZ-mediated expression changes of ZO-1, occludin, and claudin-5
  JOURNAL   J. Cell. Physiol. 230 (3), 716-731 (2015)
   PUBMED   25201524
  REMARK    GeneRIF: In conclusion, our present study indicated that miR-34c
            regulated the permeability of BTB via MAZ-mediated expression
            changes of ZO-1, occludin, and claudin-5.
REFERENCE   2  (bases 1 to 2376)
  AUTHORS   Yamagishi M, Ito Y, Ariizumi T, Komazaki S, Danno H, Michiue T and
            Asashima M.
  TITLE     Claudin5 genes encoding tight junction proteins are required for
            Xenopus heart formation
  JOURNAL   Dev. Growth Differ. 52 (7), 665-675 (2010)
   PUBMED   20887567
  REMARK    GeneRIF: The results of light- and electron-microscopic
            observations suggested that cldn5a and 5b are required for Xenopus
            heart tube formation through epithelialization of the precardiac
            mesoderm.
REFERENCE   3  (bases 1 to 2376)
  AUTHORS   Klein SL, Strausberg RL, Wagner L, Pontius J, Clifton SW and
            Richardson P.
  TITLE     Genetic and genomic tools for Xenopus research: The NIH Xenopus
            initiative
  JOURNAL   Dev. Dyn. 225 (4), 384-391 (2002)
   PUBMED   12454917
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from BC060483.1.
            On Jul 25, 2007 this sequence version replaced NM_001089977.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC060483.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMD00012418, SAMD00012419
                                           [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..2376
                     /organism="Xenopus laevis"
                     /mol_type="mRNA"
                     /db_xref="taxon:8355"
                     /chromosome="1L"
     gene            1..2376
                     /gene="cldn5.L"
                     /gene_synonym="claudin-5; cldn5"
                     /note="claudin 5 (transmembrane protein deleted in
                     velocardiofacial syndrome) L homeolog"
                     /db_xref="GeneID:398929"
                     /db_xref="Xenbase:XB-GENE-6078354"
     misc_feature    76..78
                     /gene="cldn5.L"
                     /gene_synonym="claudin-5; cldn5"
                     /note="upstream in-frame stop codon"
     CDS             85..735
                     /gene="cldn5.L"
                     /gene_synonym="claudin-5; cldn5"
                     /codon_start=1
                     /product="claudin 5 (transmembrane protein deleted in
                     velocardiofacial syndrome) L homeolog"
                     /protein_id="NP_001083445.1"
                     /db_xref="GeneID:398929"
                     /db_xref="Xenbase:XB-GENE-6078354"
                     /translation="
MASAAMEIIGLSLSILGWIGVILTCGLPMWQVSAFIENNIVVAQIIWEGLWMTCVVQSTGQMQCKVYDSILALHPELQAGRALTVLASIVGLVGLLVTIVGAKCTNCLQGSSVKSRVLLAGGIIYIVCGILLLVPLCWIANIVITEFYDPRVPASQKREMGAALYIGWGATSLLLLGGSLLCCSFAMKDGISNLPVKYSAPRIPTSNGDYDKKNYV"
     misc_feature    103..594
                     /gene="cldn5.L"
                     /gene_synonym="claudin-5; cldn5"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:304458"
     misc_feature    172..594
                     /gene="cldn5.L"
                     /gene_synonym="claudin-5; cldn5"
                     /note="PMP22_Claudin; Region: PMP-22/EMP/MP20/Claudin
                     family"
ORIGIN      
agcgcttggtatccagttggccatttggggcacagagtgagcggtgataactgtagagaagccctgctctcgaggtgactggaaatggcatccgccgcaatggagatcattggtctgtcgctgagcatcctgggctggataggggtgatcctgacctgcgggctcccaatgtggcaagtgtccgccttcatagaaaacaacatcgtggtggcgcagattatctgggaaggtctgtggatgacttgcgtggtgcaaagtacggggcagatgcagtgcaaagtctacgactccatcctcgcccttcacccggagctccaggctggcagagccctcactgtactggcctccattgtggggctcgtcgggctgctggtcaccatcgtgggcgccaagtgcaccaactgcctgcaagggagcagcgtgaagagccgggtgctgctcgccgggggcatcatctacattgtgtgcgggatcctgctgctcgtcccactctgctggatcgccaatatcgtcattaccgagttctacgaccctcgggtgccggcctcccaaaagagagagatgggggccgctttgtatataggctggggggccacttccctgctcctgcttgggggctccctcctgtgctgctcgttcgctatgaaagatggaatcagcaacctgcccgtcaagtactccgctccccgcatccccacctccaacggggattatgacaaaaagaactatgtgtagtcggtgaggggtcgcagggaacgcgtggtcctaactcagggctggactgtgacctgtacatacagtaatttggctcttccctcggtctgtgcgggctcagacacttaccgaccctgtgagcagctccaactgtcagctggtacccaggcaggtgtgatccatggacctggcagcgaccccgtccagttgggctcattacagatgaaaaaaaatctcatatctcgagggggtcggcaatacttaatggcacaagactttgggttatcttgggatcctatatccacgtacaatgtacatatacaaatagactgtgtatatttagctactttgtattttatcttctgcactgacaagggctcttctttccagctcctgggctgcaaggcagataatgccgccctccaactatcagggatccggcctccaactagggctgccagactgacccagcacagtcatatttcttattcctggtctttattctaggggaagagtaaggatacgtcattatgacaagaccagagagttcgctttgaacatgggcactgggcatatctcattttattgccatacacatattcgttttattctgttctattgtacgatgtatgtatttgggtggaatccaccaacacgtgtgttcaagcagataagcattgtgtgggagggtattcacttctaattcatgtacagattgtttaacttcttctgcagtgcacttagccagagagtaggctataaatgagatatataaccaaagtgcagacatttaaaatgtataatgtattttttaaatgtgtttaagaggcgggcacaatgtccatctctgcccattttggaaaggatttgggggtataaactatgtcaggaatttatttatgaaaatgcctttatatcatttcagtgctacagagccttgtagtgcattaccttaagcagtgtatctactatctacccagttagttctcctgttagaaaggttctttgcaaacagagtgatggggaatgcttatataagacagagcaaattgttgccttttcttgatactgcttcaaaggagagcatgactttgcacaagagcctttgttttagggtgctggccttccaaccctgtacccctcaatagcaggagtaatagtctccaatatcccaaaactgcacacataattcatcaccatagagtgactgatttcatagtagtggccatggataaaccagcttatggccaagtgggttagggaattcagaaaacacatatacatttcatcccagagtagaaaccctatgcagtcagtcagacttttacaaacggtagccccaaatgttatatcaccagtacttagctgcaggttagccatctgttaaactcactttgcacaaaatttggcagggatatatcccctatccctcctgacactgccatgaataactggatatatttctgtgttgaccattttttttacaatgcagggctggatttctttggtactgtttcaaaataaagtgctgcattatatgctttatttttgtatttgtcttccgttaatgttatattcaatcaagtcttcagttattatagtatatacataatgttgtttaaatctattaaatctctttatattatcaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]