2024-04-19 17:17:25, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001085685 742 bp mRNA linear VRT 19-JUN-2021 DEFINITION Xenopus laevis NK3 homeobox 2 S homeolog (nkx3-3.S), mRNA. ACCESSION NM_001085685 VERSION NM_001085685.1 KEYWORDS RefSeq. SOURCE Xenopus laevis (African clawed frog) ORGANISM Xenopus laevis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Xenopus. REFERENCE 1 (bases 1 to 742) AUTHORS Newman CS and Krieg PA. TITLE The Xenopus bagpipe-related homeobox gene zampogna is expressed in the pharyngeal endoderm and the visceral musculature of the midgut JOURNAL Dev Genes Evol 209 (2), 132-134 (1999) PUBMED 10022957 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from AF095721.1. ##Evidence-Data-START## Transcript exon combination :: AF095721.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMD00012420, SAMN04111061 [ECO:0000348] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..742 /organism="Xenopus laevis" /mol_type="mRNA" /db_xref="taxon:8355" /chromosome="7S" /map="7S" gene 1..742 /gene="nkx3-3.S" /gene_synonym="bapx; nkx3-3; nkx3-3.L; zampogna; zax; zax-A" /note="NK3 homeobox 2 S homeolog" /db_xref="GeneID:373704" /db_xref="Xenbase:XB-GENE-865322" CDS 68..742 /gene="nkx3-3.S" /gene_synonym="bapx; nkx3-3; nkx3-3.L; zampogna; zax; zax-A" /note="homeodomain protein zampogna; xzax; bagpipe homeobox; NK3 homeobox 2 L homeolog" /codon_start=1 /product="homeobox protein zampogna" /protein_id="NP_001079154.1" /db_xref="GeneID:373704" /db_xref="Xenbase:XB-GENE-865322" /translation="
MSLTSFSIQDILARTGGNRGKDTRTDGNNISPPPSPSADEGHNEWPRAENPPLTPEKEKTDTDSGTEDFHWERDTETANNGAFTDPSSGDRLADSPKSSKKRSRAAFSHAQVYELERRFSLQRYLSGPERADLAASLKLTETQVKIWFQNRRYKTKRKLIATQTAPKSSLVPTRKVAVRVLVKDDQRQYCPEDMLSPSLLSLYHAYQYYPYMYCLPAWVPHLPL"
misc_feature 68..388 /gene="nkx3-3.S" /gene_synonym="bapx; nkx3-3; nkx3-3.L; zampogna; zax; zax-A" /note="propagated from UniProtKB/Swiss-Prot (O93590.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 206..>541 /gene="nkx3-3.S" /gene_synonym="bapx; nkx3-3; nkx3-3.L; zampogna; zax; zax-A" /note="Homeodomain-containing transcription factor [Transcription]; Region: COG5576" /db_xref="CDD:227863" misc_feature order(368..382,386..388,437..439,455..457,494..496, 500..505,512..517,521..529,533..538) /gene="nkx3-3.S" /gene_synonym="bapx; nkx3-3; nkx3-3.L; zampogna; zax; zax-A" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 374..535 /gene="nkx3-3.S" /gene_synonym="bapx; nkx3-3; nkx3-3.L; zampogna; zax; zax-A" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature order(374..376,383..385,503..505,512..517,524..526) /gene="nkx3-3.S" /gene_synonym="bapx; nkx3-3; nkx3-3.L; zampogna; zax; zax-A" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" ORIGIN
ggcacgagcgcagcctttctcccggccattggatacttctcccggccattggatactatgcactaacatgtccctcacctccttctccattcaagatatccttgcgcggaccggaggcaataggggcaaagacacnagaactgatgggaataatatctctccgccgccctctcccagcgctgatgaggggcacaatgaatggccgcgggcggagaacccgccactgactccggagaaagagaaaacggacacagactcagggacagaggacttccactgggagcgggacacagaaacagccaacaatggtgcttttacagatccttcttctggggacagactggcagacagccccaagtccagtaagaagaggtctcgggctgctttttctcatgctcaggtttatgaactggagaggaggttcagcctgcagcggtacctctctgggcctgaaagggcagacctggcagcttctctcaaactcacagagacccaagtaaagatttggtttcagaaccggcggtacaagaccaagaggaagctgattgccacccagacagcaccaaagtcctctcttgttccaaccagaaaggtggcagtcagggtgctggtaaaggatgaccagagacaatattgccctgaggatatgctgagcccatcccttctctctttataccatgcataccagtattatccatacatgtactgtctgccagcctgggtaccccaccttccactttga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]