GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2020-11-26 23:47:06, GGRNA.v2 : RefSeq release 202 (Sep, 2020)

LOCUS       NM_001081570             558 bp    mRNA    linear   PRI 19-JUN-2020
DEFINITION  Pan troglodytes HESX homeobox 1 (HESX1), mRNA.
ACCESSION   NM_001081570 XM_001173667 XM_001173676 XM_001173683
VERSION     NM_001081570.1
KEYWORDS    RefSeq.
SOURCE      Pan troglodytes (chimpanzee)
  ORGANISM  Pan troglodytes
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Pan.
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from DQ977388.1.
            On or before Feb 17, 2007 this sequence version replaced
            XM_001173667.1, XM_001173676.1, XM_001173683.1.
            
            ##Evidence-Data-START##
            RNAseq introns :: single sample supports all introns SAMN02189947,
                              SAMN03018695 [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..558
                     /organism="Pan troglodytes"
                     /mol_type="mRNA"
                     /db_xref="taxon:9598"
                     /chromosome="3"
                     /map="3"
     gene            1..558
                     /gene="HESX1"
                     /note="HESX homeobox 1"
                     /db_xref="GeneID:747229"
                     /db_xref="VGNC:VGNC:1836"
     CDS             1..558
                     /gene="HESX1"
                     /note="homeobox, ES cell expressed 1; homeo box (expressed
                     in ES cells) 1"
                     /codon_start=1
                     /product="homeobox expressed in ES cells 1"
                     /protein_id="NP_001075039.1"
                     /db_xref="GeneID:747229"
                     /db_xref="VGNC:VGNC:1836"
                     /translation="
MSPSLQEGAQLGESKPSTCSFSIERILGLDQNKDCVPLMKPHRPWADTCSSSGKDGNLCLHVPNPPSGISFPSVVDHPMPEERALKYENYFSASERLSLKRELSWYRGRRPRTAFTQNQIEVLENVFRVNCYPGIDIREDLAQKLNLEEDRIQIWFQNRRAKLKRSHRESQFLMAKKNFNTNLLE"
     misc_feature    order(325..339,343..345,394..396,412..414,451..453,
                     457..462,469..474,478..486,490..495)
                     /gene="HESX1"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    331..492
                     /gene="HESX1"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:306543"
     misc_feature    order(331..333,340..342,460..462,469..474,481..483)
                     /gene="HESX1"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     exon            1..157
                     /gene="HESX1"
                     /inference="alignment:Splign:2.1.0"
     exon            158..357
                     /gene="HESX1"
                     /inference="alignment:Splign:2.1.0"
     exon            358..459
                     /gene="HESX1"
                     /inference="alignment:Splign:2.1.0"
     exon            460..558
                     /gene="HESX1"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
atgtctcccagccttcaggaaggcgctcagctcggggaaagcaaaccctcaacttgctccttttcaattgagagaatcttaggactggaccagaacaaagactgtgttccattaatgaaaccccacaggccctgggcagacacctgcagctcatcagggaaagatggtaacttatgtctacatgtcccaaatcctcccagtgggatttcattccctagcgtggtggatcacccaatgccagaagaaagagctttgaaatatgaaaattacttttcagcctcagaaagactgtctttgaaaagagagttgagttggtatagaggccgaagaccaagaactgcttttactcaaaaccagattgaagtgttagaaaatgtctttagagtaaactgctatcctggtatcgatattagagaagacttagctcaaaaattgaatctagaggaagacagaatccagatttggtttcaaaatcggcgtgcaaaactgaaaaggtcccatagagaatcacagtttctaatggcgaaaaaaaatttcaacacaaatctgctggaatag
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]