LOCUS       NM_001081487             555 bp    mRNA    linear   PRI 24-JUL-2024
DEFINITION  Pan troglodytes retina and anterior neural fold homeobox 2 (RAX2),
            mRNA.
ACCESSION   NM_001081487 XM_001136381 XM_524055
VERSION     NM_001081487.1
KEYWORDS    RefSeq.
SOURCE      Pan troglodytes (chimpanzee)
  ORGANISM  Pan troglodytes
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Pan.
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from DQ977350.1.
            
            On or before Feb 10, 2007 this sequence version replaced
            XM_524055.2, XM_001136381.1.
            
            ##Evidence-Data-START##
            RNAseq introns :: single sample supports all introns SAMN02045701,
                              SAMN02189948 [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..555
                     /organism="Pan troglodytes"
                     /mol_type="mRNA"
                     /db_xref="taxon:9598"
                     /chromosome="20"
                     /map="20"
     gene            1..555
                     /gene="RAX2"
                     /gene_synonym="RAXL1"
                     /note="retina and anterior neural fold homeobox 2"
                     /db_xref="GeneID:468668"
                     /db_xref="VGNC:VGNC:2273"
     CDS             1..555
                     /gene="RAX2"
                     /gene_synonym="RAXL1"
                     /note="retina and anterior neural fold homeobox like 1;
                     retina and anterior neural fold homeobox-like protein 1"
                     /codon_start=1
                     /product="retina and anterior neural fold homeobox protein
                     2"
                     /protein_id="NP_001074956.1"
                     /db_xref="GeneID:468668"
                     /db_xref="VGNC:VGNC:2273"
                     /translation="

MFLSPGEGPATEGGGLGPGEEAPKKKHRRNRTTFTTYQLHQLERAFEASHYPDVYSREELAAKVHLPEVRVQVWFQNRRAKWRRQERLESGSGAVAAPRLPEAPALPFARPPAMSLPLEPWLGPGPPAVPGLPRLLGPGPGLQASFGPHAFAPTFADGFALEEASLRLLAKEHAQAMDRAWPPA"

     misc_feature    1..99
                     /gene="RAX2"
                     /gene_synonym="RAXL1"
                     /note="propagated from UniProtKB/Swiss-Prot (A2T711.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    82..252
                     /gene="RAX2"
                     /gene_synonym="RAXL1"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     exon            1..216
                     /gene="RAX2"
                     /gene_synonym="RAXL1"
                     /inference="alignment:Splign:2.1.0"
     exon            217..555
                     /gene="RAX2"
                     /gene_synonym="RAXL1"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

atgttcctgagcccgggcgaggggccggcaaccgagggtgggggtctggggccgggcgaggaggcccccaagaagaagcaccggaggaaccgcaccaccttcaccacctaccagctgcaccagctggagcgggcgttcgaggcctctcactacccggatgtgtacagccgtgaggagctggcagccaaggtgcacctacctgaggtgcgcgtgcaggtgtggttccagaaccgccgggccaagtggcgccgccaggagcggctggagtcaggctcgggtgccgtggcagctccgagactccccgaggccccagcgctgccgttcgcccgccccccggccatgtcgctgcccctggagccctggttgggccctggaccgccggccgtgccaggcctcccccgcctcctgggcccgggcccggggctgcaagcgtccttcgggcctcatgcctttgctcccaccttcgcagatggcttcgccctggaggaggcgtccctgcggctgctggccaaggaacacgcacaggctatggacagggcctggccgccagcctga

//