2025-07-19 08:46:22, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS NM_001040416 1574 bp mRNA linear PRI 07-DEC-2024 DEFINITION Macaca mulatta msh homeobox 1 (MSX1), mRNA. ACCESSION NM_001040416 VERSION NM_001040416.2 KEYWORDS RefSeq. SOURCE Macaca mulatta (Rhesus monkey) ORGANISM Macaca mulatta Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Cercopithecidae; Cercopithecinae; Macaca. REFERENCE 1 (bases 1 to 1574) AUTHORS Perry,G.H., Verrelli,B.C. and Stone,A.C. TITLE Molecular evolution of the primate developmental genes MSX1 and PAX9 JOURNAL Mol Biol Evol 23 (3), 644-654 (2006) PUBMED 16326750 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from QNVO02000366.1. On Oct 23, 2019 this sequence version replaced NM_001040416.1. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. ##Evidence-Data-START## RNAseq introns :: single sample supports all introns SAMEA4688315, SAMEA4688317 [ECO:0000348] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-716 QNVO02000366.1 42483999-42484714 717-1574 QNVO02000366.1 42487022-42487879 FEATURES Location/Qualifiers source 1..1574 /organism="Macaca mulatta" /mol_type="mRNA" /db_xref="taxon:9544" /chromosome="5" /map="5" gene 1..1574 /gene="MSX1" /note="msh homeobox 1" /db_xref="GeneID:722771" exon 1..716 /gene="MSX1" /inference="alignment:Splign:2.1.0" CDS 248..1159 /gene="MSX1" /note="msh homeobox homolog 1; msh homeobox 1-like protein" /codon_start=1 /product="homeobox protein MSX-1" /protein_id="NP_001035506.1" /db_xref="GeneID:722771" /translation="
MAPAADMTSLPLGVKVEDSAFGKPAGGGAGQAPSAAAATAAAMGADEEGAKPKVSPSLLPFSVEALMADHRKPGAKESALAPSEGAQAAGGPAQPLGVPPGSLGAPDAPSSPRPLGHFSVGGLLKLPEDALVKAESPEKPERTPWMQSPRFSPPPARRLSPPACTLRKHKTNRKPRTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPMLPPAAFGLSFPLGGPAAVAAAAGASLYGASGPFQRAALPVAPVGLYTAHVGYSMYHLT"
misc_feature 299..415 /gene="MSX1" /note="propagated from UniProtKB/Swiss-Prot (Q2VL87.2); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 452..607 /gene="MSX1" /note="propagated from UniProtKB/Swiss-Prot (Q2VL87.2); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature <458..>991 /gene="MSX1" /note="104 kDa microneme/rhoptry antigen; Provisional; Region: PTZ00449" /db_xref="CDD:185628" misc_feature 644..736 /gene="MSX1" /note="propagated from UniProtKB/Swiss-Prot (Q2VL87.2); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 764..934 /gene="MSX1" /note="Region: Homeodomain; pfam00046" /db_xref="CDD:459649" exon 717..1574 /gene="MSX1" /inference="alignment:Splign:2.1.0" ORIGIN
agggccaggaaccggcgggtgctcccgggaactccgcctgtgttgcggcggcggcggcggcgaccaccaggagccaggcccagcgcgccggagctggcctgctggggaggggcgggaggcgcgcgcgggagggtccgccccgccagagccccgggcgctcccagaggcaggcagcgctcccagcctgccccgagcccatgcccggcggctggcccgtgctgcggcaggagggggggcccggctctgcatggccccggctgctgacatgacttctttgccactcggtgtcaaagtggaggactccgctttcggcaagccggcggggggaggcgcaggccaggcccccagcgcagccgcggccacggctgccgccatgggcgcggacgaggagggggccaagcccaaagtgtccccttcgctcctgcccttcagcgtggaggctctcatggccgaccacaggaagccgggggccaaggagagcgccctggcgccctccgagggcgcgcaggcggcgggtggcccggcgcagccactgggcgtcccgccggggtcgctgggcgccccggacgcgccctcttcgccgcggccgctcggccatttctcggtggggggactcctgaagctgccagaagatgcgctcgtcaaagccgagagccccgagaagcccgagaggacgccctggatgcagagcccccgcttctccccgccgccggccaggcggctgagccccccagcctgcaccctccgcaaacacaagacgaaccgtaagccgcggacacccttcaccaccgcgcagctgctggcactggagcgcaagttccgccagaagcagtacctgtccatcgccgagcgcgcggaattctccagctcgctcagcctcactgagacgcaggtgaagatatggttccagaaccgccgcgccaaggcaaagagactacaagaggcagagctggagaagctgaagatggccgccaagcccatgctgccaccggctgccttcggcctctccttccctcttggcggccccgcagctgtagcggccgcggcgggtgcctcgctctacggtgcctctggccccttccagcgcgctgcgctgcccgtggcgccagtgggactctacacggcccatgtaggctacagcatgtaccacctgacatagagggtcccacggtcgcccacctgtgggccatccgattcctccagccctggtgctgtacccccgacgtgctccactgctcagcaccaccagctgccttcctttaaacccccacactgctccagtttcagttctttgctccctgagttcagtctccgaagtctgatccctgccgaaaagtgactggaagggtcccttagtacttttctagaatttagatctacactctcaagttaaagatggggaaactgagggcagagcggttaagaatttatccaaggtccccagcagaattggcagttgaacagaactagaggccatgtctcctgcatagcttttccctgtcctgacaccaggcaggaaaagcgcagagaaattgatgtctgacgattttggaaatgagaacaatctcaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]