GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2020-04-07 22:57:37, GGRNA.v2 : RefSeq release 99 (Mar, 2020)

LOCUS       NM_001030987            1467 bp    mRNA    linear   VRT 29-DEC-2019
DEFINITION  Gallus gallus homeobox A6 (HOXA6), mRNA.
ACCESSION   NM_001030987 XM_418729
VERSION     NM_001030987.2
KEYWORDS    RefSeq.
SOURCE      Gallus gallus (chicken)
  ORGANISM  Gallus gallus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
            Phasianidae; Phasianinae; Gallus.
REFERENCE   1  (bases 1 to 1467)
  AUTHORS   Attia L, Yelin R and Schultheiss TM.
  TITLE     Analysis of nephric duct specification in the avian embryo
  JOURNAL   Development 139 (22), 4143-4151 (2012)
   PUBMED   23034630
  REMARK    GeneRIF: In the primitive streak, expression of the gene HoxB4 is
            associated with prospective duct IM, whereas expression of the more
            posterior Hox gene HoxA6 is associated with more posterior,
            non-duct-forming IM.
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AC163712.3.
            On Jun 14, 2017 this sequence version replaced NM_001030987.1.
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AY307380.1, ERR2365563.28012.1
                                           [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA2201357, SAMEA2201358
                                           [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-436               AC163712.3         168504-168939       c
            437-1467            AC163712.3         166278-167308       c
FEATURES             Location/Qualifiers
     source          1..1467
                     /organism="Gallus gallus"
                     /mol_type="mRNA"
                     /db_xref="taxon:9031"
                     /chromosome="2"
                     /map="2"
                     /breed="Red Jungle Fowl"
     gene            1..1467
                     /gene="HOXA6"
                     /gene_synonym="HOX1; HOX1.2; HOX1B"
                     /note="homeobox A6"
                     /db_xref="CGNC:51307"
                     /db_xref="GeneID:420630"
     CDS             1..696
                     /gene="HOXA6"
                     /gene_synonym="HOX1; HOX1.2; HOX1B"
                     /note="homeo box A6; homeo box 1B; homeobox protein HOXA6;
                     homeobox protein Hox-1B"
                     /codon_start=1
                     /product="homeobox protein Hox-A6"
                     /protein_id="NP_001026158.1"
                     /db_xref="CGNC:51307"
                     /db_xref="GeneID:420630"
                     /translation="
MSSYFVNPTFPGSLPAGQDSFLGQIPLYPAGYDALRHFPTSYGASSLQDKTYTSPCFYQQSNTVIACNRASYEYGASCFYSDKEISSASPSGSGKQRGQGDYLHFSPEQQYKSNGVQSKIVNDEGTDRKYTSPVYPWMQRMNSCAGTVYGAHGRRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKENKFINSTQPGSDETEEKSGE"
     misc_feature    400..417
                     /gene="HOXA6"
                     /gene_synonym="HOX1; HOX1.2; HOX1B"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q5YLH5.1);
                     Region: Antp-type hexapeptide"
     misc_feature    order(460..474,478..480,529..531,547..549,586..588,
                     592..597,604..609,613..621,625..630)
                     /gene="HOXA6"
                     /gene_synonym="HOX1; HOX1.2; HOX1B"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(466..468,475..477,595..597,604..609,616..618)
                     /gene="HOXA6"
                     /gene_synonym="HOX1; HOX1.2; HOX1B"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    469..627
                     /gene="HOXA6"
                     /gene_synonym="HOX1; HOX1.2; HOX1B"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:278475"
     exon            1..436
                     /gene="HOXA6"
                     /gene_synonym="HOX1; HOX1.2; HOX1B"
                     /inference="alignment:Splign:2.1.0"
     exon            437..1467
                     /gene="HOXA6"
                     /gene_synonym="HOX1; HOX1.2; HOX1B"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
atgagttcctatttcgtgaatcccactttccccgggagcctgcccgctggccaggactccttcctcgggcagatccccctgtacccggcgggctatgatgctctgaggcattttccgacttcgtacggggcgagcagcctgcaggacaagacctacacctcaccttgtttctatcaacagtccaacaccgtcattgcttgcaatcgggcttcctatgagtacggagcctcctgtttctattcagacaaggaaattagtagcgcctctccctccggcagtggcaagcagaggggacaaggggactatctgcacttttctcccgagcaacaatacaaatctaacggcgtgcaaagcaaaatcgtgaatgacgaaggcaccgaccggaagtacacgagccctgtttacccctggatgcagcggatgaactcctgtgccggtacagtatatggagctcatgggagacgagggaggcagacttacacccgctaccaaacgctagagttagagaaggagttccattttaacagatacttaacccgaagacgacgcattgagattgcgaacgctctctgccttaccgagcgccagattaaaatatggtttcaaaacaggcggatgaaatggaaaaaggaaaacaaattcataaattccacccagcccggcagcgacgaaacagaggaaaagtcaggggagtagaaccgtgtttaataaacgctaccaggcccgtccttagcgctcgctgttatattgttatttaccttgtgctccttctgctactaaaatcccataggtttctcacagcctattaatccccaccggctgatgtacccccaccggcagatgcgatcagccgggactcgctctgagacacgcacaagtccgagctttcgagctacggccgcgtacgtagataagaaccgcttctgccacgagtagatggcgtcgcttaaaacattccgagacccggcccagatcctaaaatatttgggtgtttatctgcgtgtgggagagtgtcccgggagtgcctgtgtgagaaccgacccgcgggggactgttattattgttattattgttgtgggtgtgtgattgtgaacgttcgtactgtagaaatacgagagatggtcgaacgtctcgggtttatctttttaccactcccgctacgtcgggccgcctggatacgacgtgtttgggattttatggtccgtaggggagaggggggaaaagttttacacgagtataagatattgaaatagggaaaaaaaagcagaaaaaatccttgtaaaaaaatcgttgtataaaaactcgggtatgagcttgcggattatgcgaaaatgaattgctgggagacttctgaatgccactaaactgaccccaatctgcactactgataccgagtaagagctcggtgataaactttagggcgagagagaggagaggctttgaaggggcgaatttctgtggttcccg
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]