2025-09-17 17:16:33, GGRNA.v2 : RefSeq release 231 (Jul, 2025)
LOCUS NM_001024874 829 bp mRNA linear ROD 26-FEB-2024 DEFINITION Rattus norvegicus reproductive homeobox 9 (Rhox9), mRNA. ACCESSION NM_001024874 XM_216470 VERSION NM_001024874.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 829) AUTHORS Gaudet P, Livstone MS, Lewis SE and Thomas PD. TITLE Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium JOURNAL Brief Bioinform 12 (5), 449-462 (2011) PUBMED 21873635 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from DQ058656.1. On Jun 17, 2005 this sequence version replaced XM_216470.3. ##Evidence-Data-START## Transcript exon combination :: DQ058656.1 [ECO:0000332] RNAseq introns :: mixed sample support SAMD00132271, SAMD00132274 [ECO:0006172] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..829 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="Sprague-Dawley" /db_xref="taxon:10116" /chromosome="X" /map="Xq35" gene 1..829 /gene="Rhox9" /gene_synonym="Psx4" /note="reproductive homeobox 9" /db_xref="GeneID:298352" /db_xref="RGD:1563844" exon 1..90 /gene="Rhox9" /gene_synonym="Psx4" /inference="alignment:Splign:2.1.0" CDS 9..692 /gene="Rhox9" /gene_synonym="Psx4" /note="reproductive homeobox on X chromosome, 9; Rhox homeobox family member 9; homeobox protein PSX4" /codon_start=1 /product="reproductive homeobox 9" /protein_id="NP_001020045.1" /db_xref="GeneID:298352" /db_xref="RGD:1563844" /translation="
MDTPQDSCQSFQKSLSLGAEVDPEQQHGGTAVVSEAREVGDQSQRLVGGLVQGGLDQGQPTQGQLAGGNLPQEEPAELSLAQEATGVEEEGDEKEEEMEARYAGDGAYGPEDNNVQQEGDQHPNDQEQPQQEAAIPEGNRGQQAGNRLVHPRHTRPRFTHSQLRDLERLFQETRYPSLRTRKDLARWMGVPESDVQDWFRMRRSLFRRNSRLLMFCELPPIPENNPS"
misc_feature 462..632 /gene="Rhox9" /gene_synonym="Psx4" /note="Region: Homeodomain; pfam00046" /db_xref="CDD:459649" exon 91..550 /gene="Rhox9" /gene_synonym="Psx4" /inference="alignment:Splign:2.1.0" exon 551..596 /gene="Rhox9" /gene_synonym="Psx4" /inference="alignment:Splign:2.1.0" exon 597..829 /gene="Rhox9" /gene_synonym="Psx4" /inference="alignment:Splign:2.1.0" ORIGIN
ttttcgccatggacactcctcaagacagctgccaaagtttccaaaagtctctgagtctgggagctgaggtggacccggagcaacagcatggtgggactgcagtggtctcagaggctagagaggtaggagaccaatcacagcgtttagtgggcgggcttgttcagggtgggcttgatcagggccaacccacgcagggccagttggctggaggcaaccttcctcaagaagagcctgctgagctcagtctcgctcaggaagccacaggagtagaagaggagggagacgagaaggaagaagaaatggaagcaagatatgctggtgatggtgcttacggccccgaggacaacaacgtccagcaagaaggtgaccaacaccccaatgatcaagagcagcctcagcaagaggcagccattcctgagggcaacaggggccaacaggctgggaaccggctggttcacccgcggcacactcgccccaggttcacccactctcagctgcgtgatctggagcgcctgttccaagagactcgctaccccagcttgcgaacaaggaaggaccttgcacgatggatgggtgtgccagaatctgatgtgcaggattggttccggatgagaagatctcttttccgcagaaacagcagactgctgatgttctgtgaacttccaccaattcctgagaacaacccttcttaaagattttggagcagcacttgagtgccacccctgtcccagagccacatgaggaaggcttcttctgagccacccataatggccatgactacctttacttccctacagttatttgagcaataaagacgtggattctaagt
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]