GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-10-24 19:07:32, GGRNA.v2 : RefSeq release 232 (Sep, 2025)

LOCUS       NM_001024874             829 bp    mRNA    linear   ROD 29-JUL-2025
DEFINITION  Rattus norvegicus Rhox homeobox family member 9 (Rhoxf9), mRNA.
ACCESSION   NM_001024874 XM_216470
VERSION     NM_001024874.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 829)
  AUTHORS   Gaudet,P., Livstone,M.S., Lewis,S.E. and Thomas,P.D.
  TITLE     Phylogenetic-based propagation of functional annotations within the
            Gene Ontology consortium
  JOURNAL   Brief Bioinform 12 (5), 449-462 (2011)
   PUBMED   21873635
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from DQ058656.1.
            
            On Jun 17, 2005 this sequence version replaced XM_216470.3.
            
            ##Evidence-Data-START##
            Transcript exon combination :: DQ058656.1 [ECO:0000332]
            RNAseq introns              :: mixed sample support SAMD00132271,
                                           SAMD00132274 [ECO:0006172]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..829
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="Sprague-Dawley"
                     /db_xref="taxon:10116"
                     /chromosome="X"
                     /map="Xq35"
     gene            1..829
                     /gene="Rhoxf9"
                     /gene_synonym="Psx4; Rhox9"
                     /note="Rhox homeobox family member 9"
                     /db_xref="GeneID:298352"
                     /db_xref="RGD:1563844"
     exon            1..90
                     /gene="Rhoxf9"
                     /gene_synonym="Psx4; Rhox9"
                     /inference="alignment:Splign:2.1.0"
     CDS             9..692
                     /gene="Rhoxf9"
                     /gene_synonym="Psx4; Rhox9"
                     /note="reproductive homeobox on X chromosome, 9; homeobox
                     protein PSX4; reproductive homeobox 9"
                     /codon_start=1
                     /product="Rhox homeobox family member 9"
                     /protein_id="NP_001020045.1"
                     /db_xref="GeneID:298352"
                     /db_xref="RGD:1563844"
                     /translation="
MDTPQDSCQSFQKSLSLGAEVDPEQQHGGTAVVSEAREVGDQSQRLVGGLVQGGLDQGQPTQGQLAGGNLPQEEPAELSLAQEATGVEEEGDEKEEEMEARYAGDGAYGPEDNNVQQEGDQHPNDQEQPQQEAAIPEGNRGQQAGNRLVHPRHTRPRFTHSQLRDLERLFQETRYPSLRTRKDLARWMGVPESDVQDWFRMRRSLFRRNSRLLMFCELPPIPENNPS"
     misc_feature    462..632
                     /gene="Rhoxf9"
                     /gene_synonym="Psx4; Rhox9"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     exon            91..550
                     /gene="Rhoxf9"
                     /gene_synonym="Psx4; Rhox9"
                     /inference="alignment:Splign:2.1.0"
     exon            551..596
                     /gene="Rhoxf9"
                     /gene_synonym="Psx4; Rhox9"
                     /inference="alignment:Splign:2.1.0"
     exon            597..829
                     /gene="Rhoxf9"
                     /gene_synonym="Psx4; Rhox9"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
ttttcgccatggacactcctcaagacagctgccaaagtttccaaaagtctctgagtctgggagctgaggtggacccggagcaacagcatggtgggactgcagtggtctcagaggctagagaggtaggagaccaatcacagcgtttagtgggcgggcttgttcagggtgggcttgatcagggccaacccacgcagggccagttggctggaggcaaccttcctcaagaagagcctgctgagctcagtctcgctcaggaagccacaggagtagaagaggagggagacgagaaggaagaagaaatggaagcaagatatgctggtgatggtgcttacggccccgaggacaacaacgtccagcaagaaggtgaccaacaccccaatgatcaagagcagcctcagcaagaggcagccattcctgagggcaacaggggccaacaggctgggaaccggctggttcacccgcggcacactcgccccaggttcacccactctcagctgcgtgatctggagcgcctgttccaagagactcgctaccccagcttgcgaacaaggaaggaccttgcacgatggatgggtgtgccagaatctgatgtgcaggattggttccggatgagaagatctcttttccgcagaaacagcagactgctgatgttctgtgaacttccaccaattcctgagaacaacccttcttaaagattttggagcagcacttgagtgccacccctgtcccagagccacatgaggaaggcttcttctgagccacccataatggccatgactacctttacttccctacagttatttgagcaataaagacgtggattctaagt
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]