GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-25 06:31:44, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001024850             760 bp    mRNA    linear   ROD 04-AUG-2023
DEFINITION  Mus musculus reproductive homeobox 10 (Rhox10), mRNA.
ACCESSION   NM_001024850 XM_486665
VERSION     NM_001024850.2
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 760)
  AUTHORS   Tan K, Song HW and Wilkinson MF.
  TITLE     RHOX10 drives mouse spermatogonial stem cell establishment through
            a transcription factor signaling cascade
  JOURNAL   Cell Rep 36 (3), 109423 (2021)
   PUBMED   34289349
  REMARK    GeneRIF: RHOX10 drives mouse spermatogonial stem cell establishment
            through a transcription factor signaling cascade.
REFERENCE   2  (bases 1 to 760)
  AUTHORS   Xia X, Zhou X, Quan Y, Hu Y, Xing F, Li Z, Xu B, Xu C and Zhang A.
  TITLE     Germline deletion of Cdyl causes teratozoospermia and progressive
            infertility in male mice
  JOURNAL   Cell Death Dis 10 (3), 229 (2019)
   PUBMED   30850578
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 760)
  AUTHORS   Song HW, Bettegowda A, Lake BB, Zhao AH, Skarbrevik D, Babajanian
            E, Sukhwani M, Shum EY, Phan MH, Plank TM, Richardson ME, Ramaiah
            M, Sridhar V, de Rooij DG, Orwig KE, Zhang K and Wilkinson MF.
  TITLE     The Homeobox Transcription Factor RHOX10 Drives Mouse
            Spermatogonial Stem Cell Establishment
  JOURNAL   Cell Rep 17 (1), 149-164 (2016)
   PUBMED   27681428
  REMARK    GeneRIF: RHOX10 drives mouse spermatogonial stem cell
            establishment.
REFERENCE   4  (bases 1 to 760)
  AUTHORS   Thompson CL, Ng L, Menon V, Martinez S, Lee CK, Glattfelder K,
            Sunkin SM, Henry A, Lau C, Dang C, Garcia-Lopez R, Martinez-Ferre
            A, Pombero A, Rubenstein JLR, Wakeman WB, Hohmann J, Dee N, Sodt
            AJ, Young R, Smith K, Nguyen TN, Kidney J, Kuan L, Jeromin A,
            Kaykas A, Miller J, Page D, Orta G, Bernard A, Riley Z, Smith S,
            Wohnoutka P, Hawrylycz MJ, Puelles L and Jones AR.
  TITLE     A high-resolution spatiotemporal atlas of gene expression of the
            developing mouse brain
  JOURNAL   Neuron 83 (2), 309-323 (2014)
   PUBMED   24952961
REFERENCE   5  (bases 1 to 760)
  AUTHORS   Song HW, Dann CT, McCarrey JR, Meistrich ML, Cornwall GA and
            Wilkinson MF.
  TITLE     Dynamic expression pattern and subcellular localization of the
            Rhox10 homeobox transcription factor during early germ cell
            development
  JOURNAL   Reproduction 143 (5), 611-624 (2012)
   PUBMED   22393026
  REMARK    GeneRIF: RHOX10 protein is selectively expressed in fetal
            gonocytes, germline stem cells, spermatogonia, and early
            spermatocytes and undergoes shift in subcellular location as cell
            develop.
REFERENCE   6  (bases 1 to 760)
  AUTHORS   Daggag H, Svingen T, Western PS, van den Bergen JA, McClive PJ,
            Harley VR, Koopman P and Sinclair AH.
  TITLE     The rhox homeobox gene family shows sexually dimorphic and dynamic
            expression during mouse embryonic gonad development
  JOURNAL   Biol Reprod 79 (3), 468-474 (2008)
   PUBMED   18562707
REFERENCE   7  (bases 1 to 760)
  AUTHORS   Maclean JA 2nd, Chen MA, Wayne CM, Bruce SR, Rao M, Meistrich ML,
            Macleod C and Wilkinson MF.
  TITLE     Rhox: a new homeobox gene cluster
  JOURNAL   Cell 120 (3), 369-382 (2005)
   PUBMED   15707895
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            DQ058647.1 and AK146090.1.
            
            On Apr 7, 2006 this sequence version replaced NM_001024850.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: DQ058647.1, BC100366.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00849384, SAMN01164134
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-746               DQ058647.1         1-746
            747-760             AK146090.1         729-742
FEATURES             Location/Qualifiers
     source          1..760
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="X"
                     /map="X 22.32 cM"
     gene            1..760
                     /gene="Rhox10"
                     /note="reproductive homeobox 10"
                     /db_xref="GeneID:434769"
                     /db_xref="MGI:MGI:3580249"
     exon            1..472
                     /gene="Rhox10"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    75..77
                     /gene="Rhox10"
                     /note="upstream in-frame stop codon"
     CDS             123..713
                     /gene="Rhox10"
                     /note="reproductive homeobox on X chromosome 10"
                     /codon_start=1
                     /product="reproductive homeobox on chromosome X, 10"
                     /protein_id="NP_001020021.1"
                     /db_xref="CCDS:CCDS40945.1"
                     /db_xref="GeneID:434769"
                     /db_xref="MGI:MGI:3580249"
                     /translation="
MESKYFYFDLDYYGVSFYEEVIMTESQQRAAARAAQCRFGRGVRDLHELGQDDHPTFKYTQTYSSETRKETQARPKEPEKAAGAVSRRSNSKKYTNAQMCELEKAFQETQYPDAHQRKALAKLIDVDECKVKAWFKYKRAKYRRKQKELLLSNATSGTSNNFSAQMNEDPKSSTSVPEEQIGFIVCQQHLGKSCWS"
     misc_feature    order(384..398,402..404,453..455,471..473,510..512,
                     516..521,528..533,537..545,549..554)
                     /gene="Rhox10"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(390..392,399..401,519..521,528..533,540..542)
                     /gene="Rhox10"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    402..551
                     /gene="Rhox10"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
     exon            473..518
                     /gene="Rhox10"
                     /inference="alignment:Splign:2.1.0"
     exon            519..760
                     /gene="Rhox10"
                     /inference="alignment:Splign:2.1.0"
     polyA_site      760
                     /gene="Rhox10"
                     /note="putative"
ORIGIN      
tccgtgcctaagtttagccacacccaggagctagttaggtgaatagtgtgggacatgcgcaggattttagcccgtgaactaggaggtgctccagagtaggctccatctgcaaagctctagcaatggagagcaaatacttctacttcgacctcgattattatggggtaagcttctatgaggaagtaataatgactgaatctcagcagagggctgcggccagggcagcccaatgtcgctttggaagaggtgtaagagacctgcacgagctgggccaggacgaccacccgacctttaaatacacgcaaacctacagctctgaaacaagaaaggaaactcaagcccgtcccaaagagcccgagaaagcagcgggagcagtttctcgtcgctccaacagcaagaagtacaccaatgcccaaatgtgtgaactagagaaggctttccaagagacccagtatcctgatgcacaccaaagaaaagcacttgcaaaacttattgatgtggacgaatgcaaggtgaaggcttggtttaaatataagagagctaaatacaggagaaaacaaaaggagttactactcagcaatgctacatctggaacctcgaacaacttttcggctcagatgaatgaagaccccaagagtagtacctctgttcctgaggagcaaatagggttcattgtgtgccagcaacatcttggcaaatcctgctggtcatgaagatattgttttgtcacatataatagcaataaaggagatgttcatcc
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]