2024-04-25 06:31:44, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001024850 760 bp mRNA linear ROD 04-AUG-2023 DEFINITION Mus musculus reproductive homeobox 10 (Rhox10), mRNA. ACCESSION NM_001024850 XM_486665 VERSION NM_001024850.2 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 760) AUTHORS Tan K, Song HW and Wilkinson MF. TITLE RHOX10 drives mouse spermatogonial stem cell establishment through a transcription factor signaling cascade JOURNAL Cell Rep 36 (3), 109423 (2021) PUBMED 34289349 REMARK GeneRIF: RHOX10 drives mouse spermatogonial stem cell establishment through a transcription factor signaling cascade. REFERENCE 2 (bases 1 to 760) AUTHORS Xia X, Zhou X, Quan Y, Hu Y, Xing F, Li Z, Xu B, Xu C and Zhang A. TITLE Germline deletion of Cdyl causes teratozoospermia and progressive infertility in male mice JOURNAL Cell Death Dis 10 (3), 229 (2019) PUBMED 30850578 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 760) AUTHORS Song HW, Bettegowda A, Lake BB, Zhao AH, Skarbrevik D, Babajanian E, Sukhwani M, Shum EY, Phan MH, Plank TM, Richardson ME, Ramaiah M, Sridhar V, de Rooij DG, Orwig KE, Zhang K and Wilkinson MF. TITLE The Homeobox Transcription Factor RHOX10 Drives Mouse Spermatogonial Stem Cell Establishment JOURNAL Cell Rep 17 (1), 149-164 (2016) PUBMED 27681428 REMARK GeneRIF: RHOX10 drives mouse spermatogonial stem cell establishment. REFERENCE 4 (bases 1 to 760) AUTHORS Thompson CL, Ng L, Menon V, Martinez S, Lee CK, Glattfelder K, Sunkin SM, Henry A, Lau C, Dang C, Garcia-Lopez R, Martinez-Ferre A, Pombero A, Rubenstein JLR, Wakeman WB, Hohmann J, Dee N, Sodt AJ, Young R, Smith K, Nguyen TN, Kidney J, Kuan L, Jeromin A, Kaykas A, Miller J, Page D, Orta G, Bernard A, Riley Z, Smith S, Wohnoutka P, Hawrylycz MJ, Puelles L and Jones AR. TITLE A high-resolution spatiotemporal atlas of gene expression of the developing mouse brain JOURNAL Neuron 83 (2), 309-323 (2014) PUBMED 24952961 REFERENCE 5 (bases 1 to 760) AUTHORS Song HW, Dann CT, McCarrey JR, Meistrich ML, Cornwall GA and Wilkinson MF. TITLE Dynamic expression pattern and subcellular localization of the Rhox10 homeobox transcription factor during early germ cell development JOURNAL Reproduction 143 (5), 611-624 (2012) PUBMED 22393026 REMARK GeneRIF: RHOX10 protein is selectively expressed in fetal gonocytes, germline stem cells, spermatogonia, and early spermatocytes and undergoes shift in subcellular location as cell develop. REFERENCE 6 (bases 1 to 760) AUTHORS Daggag H, Svingen T, Western PS, van den Bergen JA, McClive PJ, Harley VR, Koopman P and Sinclair AH. TITLE The rhox homeobox gene family shows sexually dimorphic and dynamic expression during mouse embryonic gonad development JOURNAL Biol Reprod 79 (3), 468-474 (2008) PUBMED 18562707 REFERENCE 7 (bases 1 to 760) AUTHORS Maclean JA 2nd, Chen MA, Wayne CM, Bruce SR, Rao M, Meistrich ML, Macleod C and Wilkinson MF. TITLE Rhox: a new homeobox gene cluster JOURNAL Cell 120 (3), 369-382 (2005) PUBMED 15707895 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from DQ058647.1 and AK146090.1. On Apr 7, 2006 this sequence version replaced NM_001024850.1. ##Evidence-Data-START## Transcript exon combination :: DQ058647.1, BC100366.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN00849384, SAMN01164134 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-746 DQ058647.1 1-746 747-760 AK146090.1 729-742 FEATURES Location/Qualifiers source 1..760 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6" /db_xref="taxon:10090" /chromosome="X" /map="X 22.32 cM" gene 1..760 /gene="Rhox10" /note="reproductive homeobox 10" /db_xref="GeneID:434769" /db_xref="MGI:MGI:3580249" exon 1..472 /gene="Rhox10" /inference="alignment:Splign:2.1.0" misc_feature 75..77 /gene="Rhox10" /note="upstream in-frame stop codon" CDS 123..713 /gene="Rhox10" /note="reproductive homeobox on X chromosome 10" /codon_start=1 /product="reproductive homeobox on chromosome X, 10" /protein_id="NP_001020021.1" /db_xref="CCDS:CCDS40945.1" /db_xref="GeneID:434769" /db_xref="MGI:MGI:3580249" /translation="
MESKYFYFDLDYYGVSFYEEVIMTESQQRAAARAAQCRFGRGVRDLHELGQDDHPTFKYTQTYSSETRKETQARPKEPEKAAGAVSRRSNSKKYTNAQMCELEKAFQETQYPDAHQRKALAKLIDVDECKVKAWFKYKRAKYRRKQKELLLSNATSGTSNNFSAQMNEDPKSSTSVPEEQIGFIVCQQHLGKSCWS"
misc_feature order(384..398,402..404,453..455,471..473,510..512, 516..521,528..533,537..545,549..554) /gene="Rhox10" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(390..392,399..401,519..521,528..533,540..542) /gene="Rhox10" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 402..551 /gene="Rhox10" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" exon 473..518 /gene="Rhox10" /inference="alignment:Splign:2.1.0" exon 519..760 /gene="Rhox10" /inference="alignment:Splign:2.1.0" polyA_site 760 /gene="Rhox10" /note="putative" ORIGIN
tccgtgcctaagtttagccacacccaggagctagttaggtgaatagtgtgggacatgcgcaggattttagcccgtgaactaggaggtgctccagagtaggctccatctgcaaagctctagcaatggagagcaaatacttctacttcgacctcgattattatggggtaagcttctatgaggaagtaataatgactgaatctcagcagagggctgcggccagggcagcccaatgtcgctttggaagaggtgtaagagacctgcacgagctgggccaggacgaccacccgacctttaaatacacgcaaacctacagctctgaaacaagaaaggaaactcaagcccgtcccaaagagcccgagaaagcagcgggagcagtttctcgtcgctccaacagcaagaagtacaccaatgcccaaatgtgtgaactagagaaggctttccaagagacccagtatcctgatgcacaccaaagaaaagcacttgcaaaacttattgatgtggacgaatgcaaggtgaaggcttggtttaaatataagagagctaaatacaggagaaaacaaaaggagttactactcagcaatgctacatctggaacctcgaacaacttttcggctcagatgaatgaagaccccaagagtagtacctctgttcctgaggagcaaatagggttcattgtgtgccagcaacatcttggcaaatcctgctggtcatgaagatattgttttgtcacatataatagcaataaaggagatgttcatcc
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]