GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2020-04-06 12:15:33, GGRNA.v2 : RefSeq release 99 (Mar, 2020)

LOCUS       NM_001016851            2983 bp    mRNA    linear   VRT 23-DEC-2019
DEFINITION  Xenopus tropicalis claudin 12 (cldn12), mRNA.
ACCESSION   NM_001016851 NM_001015839
VERSION     NM_001016851.2
KEYWORDS    RefSeq.
SOURCE      Xenopus tropicalis (tropical clawed frog)
  ORGANISM  Xenopus tropicalis
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae;
            Xenopus; Silurana.
REFERENCE   1  (bases 1 to 2983)
  AUTHORS   Klein SL, Strausberg RL, Wagner L, Pontius J, Clifton SW and
            Richardson P.
  TITLE     Genetic and genomic tools for Xenopus research: The NIH Xenopus
            initiative
  JOURNAL   Dev. Dyn. 225 (4), 384-391 (2002)
   PUBMED   12454917
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from CR855430.2.
            On or before Oct 7, 2010 this sequence version replaced
            NM_001015839.1, NM_001016851.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: CR855430.2, BC090128.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMD00028290, SAMD00028291
                                           [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
FEATURES             Location/Qualifiers
     source          1..2983
                     /organism="Xenopus tropicalis"
                     /mol_type="mRNA"
                     /db_xref="taxon:8364"
                     /chromosome="6"
                     /map="6"
     gene            1..2983
                     /gene="cldn12"
                     /gene_synonym="claudin-12"
                     /note="claudin 12"
                     /db_xref="GeneID:549605"
                     /db_xref="Xenbase:XB-GENE-974236"
     CDS             57..794
                     /gene="cldn12"
                     /gene_synonym="claudin-12"
                     /codon_start=1
                     /product="claudin-12"
                     /protein_id="NP_001016851.1"
                     /db_xref="GeneID:549605"
                     /db_xref="Xenbase:XB-GENE-974236"
                     /translation="
MGCQEVHAVTLFAFVCGTASISGLFAATLLPQWRQMKLYTYNRNEKNLTVSIGLWVKCTRLEWSRECMMYDMEWYASVDQLDIRVLQFALPFSILTAASALILCLTGICNTTFTSGVPNLKLVKCLVNSSGCHLVAGLLYILAGIMSIMPSIWSVFYNSVLNTKYGPYFTYDIAVFVAIGSSGGMFFTAVLLFLWYCACKSLPSPFWQPLYSHVPSMHSYVPPSYQSRSRMSAIEIDIPVVTHTA"
     regulatory      2946..2951
                     /regulatory_class="polyA_signal_sequence"
                     /gene="cldn12"
                     /gene_synonym="claudin-12"
     polyA_site      2965
                     /gene="cldn12"
                     /gene_synonym="claudin-12"
ORIGIN      
cgcttagctcgctgcttgttccttgctggctgccagaactttcaagagagaccataatgggctgtcaggaagtccacgcagtgaccttattcgccttcgtatgcgggacagcctccatctcggggctctttgctgccactctgctgcctcagtggaggcaaatgaaactttacacgtacaaccggaatgagaaaaacctgactgttagcattgggctgtgggtgaaatgcacacgcttggagtggagcagggagtgcatgatgtatgacatggagtggtacgcaagcgtggatcagctggacatccgtgttctgcaattcgctctgccctttagcatcctgaccgctgcctcggcactcatattgtgtctgactggaatctgtaacactacctttacctccggtgtgccaaacctaaagcttgtcaaatgcctcgttaacagttctgggtgccatcttgtggcagggctgttatatatactagcaggtatcatgagcattatgccatccatctggtctgtgttttacaacagcgttctaaacaccaagtacgggccctactttacttacgacattgcagtttttgtggctattggcagttctgggggcatgttctttactgctgtcctgctgtttctgtggtattgtgcctgcaaatctctgccctctccattctggcagcccttgtattcccacgtccctagtatgcacagctacgtgcccccgtcctaccagtctcgctcccgcatgtcagccattgagatagacattcccgttgttacacacactgcctaacgttagcatggtatgcctgtgcttatggactttcatggtacacctcacttttgtgtatatatatattatttttttttgtacatattaggattccttcaatttgtttccacttctctttttttcttgtgtaacctgctaaggtagtacttacagtatcccaacagtgctatgatttgttgatccaacttggacacagatctaagaacaataacctccctgtaaataatgccttaggattacttaacctaaaatactagctgccctgatataaaaataaatagaaatataaaaaaaaaaaaaaaatttagtgggtaatataacaggagcagtggttgctccaggtctagtaaaccactagaccagatgtttgctttctctgattggctgcatttctagaactggtgcagacttatttatacattaccccaatactgtttatcatgggagggtagaacacacaatactttttagcctttacaagcagactgtattcatatgggatttctcaaaactgatccaagggcttactctgagcgataattataaaatatggttataaatgataatattgccaaccattactgtgtgtgtgggcagctatagccacaggacgtttggtaggaatgggaaaatggtctcaagaatgactgtgccatctactcttgcatgctgggattatataatccgggtttagggcctgttggattggcctctgctttttaatgctaagtgactttagtgccaattcccgattggcaaaggtacaataacactgaattattttttcttttgatgaactgaagcaaaatagtaattgacctgtatctgtaacactataatacagcaacacgttacttttagtagtgtaagtttgtaataagagtcagtatgtatatttattgttaattggaaagcttaatttttatgcatttgtatttaaagttgtttcagctacaaatatgaaactagcacccctcgttctccctaggttgtagcatccagaactagccattgattgagagaggatgctgggaattatagtttatccgtgctggaagactaccatctattctttatctagtagggattattgtatattttatgctgtgacaagtgtttacagaagtagactaaatcactggtgttctgtttagtactggtttctcaagtgcattcctataaaatgtctcttttctattttgtttgttctgttccagtacagtatattgagcaaaactgctgctaaatgaattgtgtaatgcactgtagataatcttacgtatctgcctttaaattgtgtgcttgtatcatgcattaaaggcaaactcatttttgggggaaaaaagctgattatttgtgcctgtgagcctattttatagagttctagttgggttgttcccccaaatatgcattattgtaacctaattctgtataggctgtaagatttttatactacagaataataataatgtggtgtgttattactttatataaatgtgaaacataaaacagcattgcagtaaagaggctttgtttaccttcccctttctagaatagaaataggattttgtgttctctttacaatacacattttgcagtgacttattatttttaatctacagtacattccctttctgtatactttttatttacatatcatgctgccatgtgtcatgttataaggataatgtcccacagggttattagtcgcctgcggttaaatctgggcaacatatctacccagaatgctttcttactggctataaagtgaatcgctgggggcaaaacataagcagcgcctcattttccaaagttgtctgaagttttctcaggtgacttcagaaaacaaagtgcagcaaattttgagcagatatcggtcggtccccatacacacacagataagctcggacacaagcaagacatggggctagggtacatggtaaaacaggatatttccttctctagactctgcagtaaaactgcatgatgtatatatctctctgctgcacatggctgggaattgtgctgcttttggtatcgatgtatttcatgtgctcagtatatatgtgcaccttttatgactacacgagtccatttctgtgccactaatgggctagtatgtaattattactgtgctattggcacgcgctcaataaaaacttttttaatacaaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]