ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-06-14 21:52:41, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS NM_001012022 1824 bp mRNA linear ROD 08-OCT-2024 DEFINITION Rattus norvegicus claudin 4 (Cldn4), mRNA. ACCESSION NM_001012022 XM_222090 VERSION NM_001012022.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 1824) AUTHORS Jie,H., Jie,W., Yingxue,G., Xin,Z., Runnan,X., Wenjie,H., Jianxiong,M. and Bodong,L. TITLE Cldn4 overexpression promotes penile cavernous smooth muscle cell fibrotic response via the JNK signaling pathway JOURNAL J Sex Med 21 (6), 511-521 (2024) PUBMED 38477100 REMARK GeneRIF: Cldn4 overexpression promotes penile cavernous smooth muscle cell fibrotic response via the JNK signaling pathway. REFERENCE 2 (bases 1 to 1824) AUTHORS Ren,Q., Xu,Y., Xu,L., Lu,Y. and Zheng,Y. TITLE Hypoxic bone marrow mesenchymal stem cell-derived exosomal lncRNA XIST attenuates lipopolysaccharide-induced acute lung injury via the miR-455-3p/Claudin-4 axis JOURNAL Int Immunopharmacol 125 (Pt A), 111066 (2023) PUBMED 37866316 REMARK GeneRIF: Hypoxic bone marrow mesenchymal stem cell-derived exosomal lncRNA XIST attenuates lipopolysaccharide-induced acute lung injury via the miR-455-3p/Claudin-4 axis. REFERENCE 3 (bases 1 to 1824) AUTHORS Xu,X., Zhang,X., Gao,L., Liu,C. and You,K. TITLE Neonatal Hyperoxia Downregulates Claudin-4, Occludin, and ZO-1 Expression in Rat Kidney Accompanied by Impaired Proximal Tubular Development JOURNAL Oxid Med Cell Longev 2020, 2641461 (2020) PUBMED 33343804 REMARK GeneRIF: Neonatal Hyperoxia Downregulates Claudin-4, Occludin, and ZO-1 Expression in Rat Kidney Accompanied by Impaired Proximal Tubular Development. Publication Status: Online-Only REFERENCE 4 (bases 1 to 1824) AUTHORS Berndt,P., Winkler,L., Cording,J., Breitkreuz-Korff,O., Rex,A., Dithmer,S., Rausch,V., Blasig,R., Richter,M., Sporbert,A., Wolburg,H., Blasig,I.E. and Haseloff,R.F. TITLE Tight junction proteins at the blood-brain barrier: far more than claudin-5 JOURNAL Cell Mol Life Sci 76 (10), 1987-2002 (2019) PUBMED 30734065 REFERENCE 5 (bases 1 to 1824) AUTHORS Jo,C.H., Kim,S., Oh,I.H., Park,J.S. and Kim,G.H. TITLE Alteration of Tight Junction Protein Expression in Dahl Salt-Sensitive Rat Kidney JOURNAL Kidney Blood Press Res 42 (6), 951-960 (2017) PUBMED 29179201 REMARK GeneRIF: Both upregulation of claudin-4 and downregulation of occludin might increase paracellular NaCl transport in the kidney, resulting in impaired pressure natriuresis in SS rats. REFERENCE 6 (bases 1 to 1824) AUTHORS Kondoh,M., Masuyama,A., Takahashi,A., Asano,N., Mizuguchi,H., Koizumi,N., Fujii,M., Hayakawa,T., Horiguchi,Y. and Watanbe,Y. TITLE A novel strategy for the enhancement of drug absorption using a claudin modulator JOURNAL Mol Pharmacol 67 (3), 749-756 (2005) PUBMED 15602007 REMARK GeneRIF: Clostridium enterotoxin enhances the absorption of dextran in rat jejunum, apparently through interactions with claudin-4. REFERENCE 7 (bases 1 to 1824) AUTHORS Tsukahara,M., Nagai,H., Kamiakito,T., Kawata,H., Takayashiki,N., Saito,K. and Tanaka,A. TITLE Distinct expression patterns of claudin-1 and claudin-4 in intraductal papillary-mucinous tumors of the pancreas JOURNAL Pathol Int 55 (2), 63-69 (2005) PUBMED 15693851 REFERENCE 8 (bases 1 to 1824) AUTHORS Peppi,M. and Ghabriel,M.N. TITLE Tissue-specific expression of the tight junction proteins claudins and occludin in the rat salivary glands JOURNAL J Anat 205 (4), 257-266 (2004) PUBMED 15447685 REFERENCE 9 (bases 1 to 1824) AUTHORS Acharya,P., Beckel,J., Ruiz,W.G., Wang,E., Rojas,R., Birder,L. and Apodaca,G. TITLE Distribution of the tight junction proteins ZO-1, occludin, and claudin-4, -8, and -12 in bladder epithelium JOURNAL Am J Physiol Renal Physiol 287 (2), F305-F318 (2004) PUBMED 15068973 REFERENCE 10 (bases 1 to 1824) AUTHORS Morita,K., Furuse,M., Fujimoto,K. and Tsukita,S. TITLE Claudin multigene family encoding four-transmembrane domain protein components of tight junction strands JOURNAL Proc Natl Acad Sci U S A 96 (2), 511-516 (1999) PUBMED 9892664 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from BC083582.1. On Feb 11, 2005 this sequence version replaced XM_222090.1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript is intronless :: BC083582.1, DN932106.1 [ECO:0000345] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..1824 /organism="Rattus norvegicus" /mol_type="mRNA" /db_xref="taxon:10116" /chromosome="12" /map="12q12" gene 1..1824 /gene="Cldn4" /note="claudin 4" /db_xref="GeneID:304407" /db_xref="RGD:1307932" exon 1..1799 /gene="Cldn4" /inference="alignment:Splign:2.1.0" misc_feature 186..188 /gene="Cldn4" /note="upstream in-frame stop codon" CDS 192..824 /gene="Cldn4" /codon_start=1 /product="claudin-4" /protein_id="NP_001012022.1" /db_xref="GeneID:304407" /db_xref="RGD:1307932" /translation="
MASMGLQVLGISLAVLGWLGVILSCSLPMWRVTAFIGSNIVTAQTSWEGLWMNCVVQSTGQMQCKMYDSMLALPQDLQAARALMVISIIVGALGMLLSVVGGKCTNCMEDETVKAKVMITAGAVFIVASMLIMVPVSWTAHNVIRDFYNPLVASGQKREMGASLYIGWAASGLLLLGGGLLCCNCPPRRNEKPYSAKYSAARSVPASNYV"
misc_feature 201..701
/gene="Cldn4"
/note="PMP-22/EMP/MP20/Claudin family; Region:
PMP22_Claudin; cl21598"
/db_xref="CDD:473919"
ORIGIN
ccgctcccaattgcaggtgcgggctggaaagagctgcagtgttcgcgcttggtagctggtggaccgggctcagcaccttcggctggctttgtgtcccagaggctcaccggaaaaagactttctcagccctcggactccagagagagatacttttcgtgctccccaaccttgactcctgcagaagctgagcgatggcgtccatggggctgcaggtgctgggaatctccttggccgtcctgggctggttaggagtcatcctgagttgttcgctccccatgtggcgggtgaccgccttcatcggcagcaacatcgtcacggcgcagacgagctgggaaggcctgtggatgaactgcgtggtgcagagcaccggccagatgcagtgcaagatgtacgactcgatgctggccctgccgcaggacctgcaggccgcccgagccctgatggtcatcagcatcatcgtgggtgctctggggatgcttctctcagtcgtagggggcaagtgcaccaactgcatggaggacgagaccgtcaaggccaaggtcatgatcacagccggagccgtgttcatcgtggcaagcatgctgattatggtgcctgtgtcctggacggcacacaacgtcatccgcgacttctacaaccctctggtggcttccgggcagaaaagggagatgggggcctcgctttacatcggctgggcggcttctgggctgctgctcctgggaggaggcctcctctgctgcaattgcccacctcgccgcaacgaaaagccctactccgccaagtactccgccgcccgctctgttcccgccagcaactatgtgtaaggtgggccactctctgtccacattgcctttattttcttggattgaactcataacggcctgtggcccctcacattctccaggacctgaccagctgtgggctactgactgcttgcaaacccggactgtgctaagttactagcgtgtagcccttggggacccacctggcccatctggacacatctcaaggctccagcgaggatagatgtaaaaatatttccttgcttgcatccagattgctcatggatacggggctgaaggcagaagcagctgtctgggtacgacagtggagggggagctgggtcctgctggccgggatagctcagctgtgactttggtctctggagtggatgtcctggtcatgttagcaaacattcactgccctttctcagtgccctcgctctctcgcctccacgttactcccgcgctactcttgccgtttctcgcccgcgtttctgagcacaccaggtcctgcctggagtcttggtgtcgaggatgactgactgaaggggcctttgagagctgatgggttctgccatggactcctcccggtgattagcaatgactggggccttacccacccacctaccctcgtaatgaagttctgtggagtggctggacaggtttgagggaagggtggaggtggtttaaactggtttggggagtgctagggctggggacccagaagcagcccagggtgtccccacccctttcccatacggtcttgctaaatgttctgatctctgtataccccctccctcttcagaaggaccctgggtgggcccctctgaattccctacccttgtccatttcaaggacgctggccagtctgtggaaggtacgggggtctgatggcattgcaccagggagcctcctggactcccttgccttctctgtggtttcttgttttgtaatttaaggtctgttcacagctgtaattattattttctacaataaatggcacctgcatacaggaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]