GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2019-03-26 15:03:52, GGRNA.v2 : RefSeq release 92 (Jan, 2019)

LOCUS       NM_001009335            1196 bp    mRNA    linear   MAM 15-SEP-2018
DEFINITION  Ovis aries homeobox C6 (HOXC6), mRNA.
ACCESSION   NM_001009335
VERSION     NM_001009335.1
KEYWORDS    RefSeq.
SOURCE      Ovis aries (sheep)
  ORGANISM  Ovis aries
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;
            Pecora; Bovidae; Caprinae; Ovis.
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from U33049.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: U33049.1 [ECO:0000332]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1196
                     /organism="Ovis aries"
                     /mol_type="mRNA"
                     /db_xref="taxon:9940"
                     /chromosome="3"
                     /map="3"
     gene            1..1196
                     /gene="HOXC6"
                     /note="homeobox C6"
                     /db_xref="GeneID:443349"
     CDS             13..474
                     /gene="HOXC6"
                     /function="unknown"
                     /note="homeo box C6; Antennapedia-type homeotic factor"
                     /codon_start=1
                     /product="homeobox protein Hox-C6"
                     /protein_id="NP_001009335.1"
                     /db_xref="GeneID:443349"
                     /translation="
MLSNCRQNTLGHNTQTSIAQDFSSEQGRTAPQDQKASIQIYPWMQRMNSHSGVGYGADRRRGRQIYSRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKESNLTSTLSGGGGGAAADSLGGKEEKREETEEEKQKE"
     misc_feature    130..147
                     /gene="HOXC6"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P49925.1);
                     Region: Antp-type hexapeptide"
     misc_feature    order(190..204,208..210,259..261,277..279,316..318,
                     322..327,334..339,343..351,355..360)
                     /gene="HOXC6"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(196..198,205..207,325..327,334..339,346..348)
                     /gene="HOXC6"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    199..357
                     /gene="HOXC6"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:306543"
     STS             58..267
                     /gene="HOXC6"
                     /standard_name="MARC_44017-44022:1098368610:3"
                     /db_xref="UniSTS:471619"
ORIGIN      
ggggagaaagacatgctctcaaactgcagacaaaacaccttaggacataacacacagacctcaatcgctcaggattttagttctgagcagggcaggactgcgccccaggaccagaaagccagtatccagatttacccctggatgcagcgaatgaattcgcacagtggggtcggctatggagcggaccggaggcgcggtcgccaaatctactcgaggtaccagacgctggaactggagaaggaatttcacttcaaccgctacctaacgcggcgccggcgcatcgagatcgccaacgcgctctgcctgaccgagcgacagatcaagatctggttccagaaccgccggatgaagtggaaaaaagagtctaacctcacgtccacgctctcagggggcggcggaggggccgcggctgacagcctgggcggaaaagaggaaaagcgggaagagacagaggaggagaagcagaaagagtgaccaggactgtccctgccacccctctttctcctgctccctcgctgcccccataccctcctaatcacacactcgatatttatcactggcacaattgatgtgtttggactccctgagacaaaattagggagtcaaatatggacctgaagagtcaactctggacgcccccctccctcaccgcacaaactcttttcaccaggcgcctcctcctcctcgctccctcgctagctcgttctcggctcgtctgcaggccccttcgcccgcccaggccttggggctcgtcctgaacctcgctttagactccacagatctccctccaaacgaggacttggcctcccaccccctcggcgccccccatctccgcccccgcgcagagagccggctcccgggccccggggctctgctcccggcctcggggcctcgcagccgggagggcgggaggcaggagggcgtcggggccccacagcagcccccagggcctccccgcagcccctgcccggcccctctgccccagcaaatgcccagcccaggcgaattgtatttaaagaatcctgggggtcattatggcatattacaaactgtgaccgtttctgtgtgaatatttttagctgtatttgtggtctctgtatttatatttatgtttagcaccgtccgtgttccaatcccatcttaaaaaggaaaaaaaaaaaaaaagagggaaaattacaaaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]