GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2019-03-25 15:19:49, GGRNA.v2 : RefSeq release 92 (Jan, 2019)

LOCUS       NM_001007134            1764 bp    mRNA    linear   VRT 13-OCT-2018
DEFINITION  Danio rerio ladybird homeobox 2 (lbx2), mRNA.
ACCESSION   NM_001007134
VERSION     NM_001007134.1
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Cyprinidae; Danio.
REFERENCE   1  (bases 1 to 1764)
  AUTHORS   Wang J, Luo J, Chen Q, Wang X, He J, Zhang W, Yin Z, Zheng F, Pan
            H, Li T, Lou Q and Wang B.
  TITLE     Identification of LBX2 as a novel causal gene of atrial septal
            defect
  JOURNAL   Int. J. Cardiol. 265, 188-194 (2018)
   PUBMED   29669692
REFERENCE   2  (bases 1 to 1764)
  AUTHORS   Masselink W, Masaki M, Sieiro D, Marcelle C and Currie PD.
  TITLE     Phosphorylation of Lbx1 controls lateral myoblast migration into
            the limb
  JOURNAL   Dev. Biol. 430 (2), 302-309 (2017)
   PUBMED   28843494
REFERENCE   3  (bases 1 to 1764)
  AUTHORS   Naylor RW, Skvarca LB, Thisse C, Thisse B, Hukriede NA and Davidson
            AJ.
  TITLE     BMP and retinoic acid regulate anterior-posterior patterning of the
            non-axial mesoderm across the dorsal-ventral axis
  JOURNAL   Nat Commun 7, 12197 (2016)
   PUBMED   27406002
  REMARK    Publication Status: Online-Only
REFERENCE   4  (bases 1 to 1764)
  AUTHORS   Pasquier J, Cabau C, Nguyen T, Jouanno E, Severac D, Braasch I,
            Journot L, Pontarotti P, Klopp C, Postlethwait JH, Guiguen Y and
            Bobe J.
  TITLE     Gene evolution and gene expression after whole genome duplication
            in fish: the PhyloFish database
  JOURNAL   BMC Genomics 17, 368 (2016)
   PUBMED   27189481
  REMARK    Publication Status: Online-Only
REFERENCE   5  (bases 1 to 1764)
  AUTHORS   Guo L, Yamashita H, Kou I, Takimoto A, Meguro-Horike M, Horike S,
            Sakuma T, Miura S, Adachi T, Yamamoto T, Ikegawa S, Hiraki Y and
            Shukunami C.
  TITLE     Functional Investigation of a Non-coding Variant Associated with
            Adolescent Idiopathic Scoliosis in Zebrafish: Elevated Expression
            of the Ladybird Homeobox Gene Causes Body Axis Deformation
  JOURNAL   PLoS Genet. 12 (1), e1005802 (2016)
   PUBMED   26820155
  REMARK    Publication Status: Online-Only
REFERENCE   6  (bases 1 to 1764)
  AUTHORS   Hinits Y, Osborn DP and Hughes SM.
  TITLE     Differential requirements for myogenic regulatory factors
            distinguish medial and lateral somitic, cranial and fin muscle
            fibre populations
  JOURNAL   Development 136 (3), 403-414 (2009)
   PUBMED   19141670
REFERENCE   7  (bases 1 to 1764)
  AUTHORS   Wotton KR, Weierud FK, Dietrich S and Lewis KE.
  TITLE     Comparative genomics of Lbx loci reveals conservation of identical
            Lbx ohnologs in bony vertebrates
  JOURNAL   BMC Evol. Biol. 8, 171 (2008)
   PUBMED   18541024
  REMARK    Publication Status: Online-Only
REFERENCE   8  (bases 1 to 1764)
  AUTHORS   Koudijs MJ, den Broeder MJ, Groot E and van Eeden FJ.
  TITLE     Genetic analysis of the two zebrafish patched homologues identifies
            novel roles for the hedgehog signaling pathway
  JOURNAL   BMC Dev. Biol. 8, 15 (2008)
   PUBMED   18284698
  REMARK    Publication Status: Online-Only
REFERENCE   9  (bases 1 to 1764)
  AUTHORS   Woods IG, Wilson C, Friedlander B, Chang P, Reyes DK, Nix R, Kelly
            PD, Chu F, Postlethwait JH and Talbot WS.
  TITLE     The zebrafish gene map defines ancestral vertebrate chromosomes
  JOURNAL   Genome Res. 15 (9), 1307-1314 (2005)
   PUBMED   16109975
REFERENCE   10 (bases 1 to 1764)
  AUTHORS   Haines L, Neyt C, Gautier P, Keenan DG, Bryson-Richardson RJ,
            Hollway GE, Cole NJ and Currie PD.
  TITLE     Met and Hgf signaling controls hypaxial muscle and lateral line
            development in the zebrafish
  JOURNAL   Development 131 (19), 4857-4869 (2004)
   PUBMED   15342468
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from BC075912.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC075912.1, AJ295165.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA2168446, SAMEA2168447
                                           [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1764
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /db_xref="taxon:7955"
                     /chromosome="14"
                     /map="14"
     gene            1..1764
                     /gene="lbx2"
                     /gene_synonym="fc26c12; homeobox; lbx; lbx1; lbx1h;
                     SI:zC207O21.2; wu:fc26c12; zgc:92170"
                     /note="ladybird homeobox 2"
                     /db_xref="GeneID:64276"
                     /db_xref="ZFIN:ZDB-GENE-001206-2"
     exon            1..637
                     /gene="lbx2"
                     /gene_synonym="fc26c12; homeobox; lbx; lbx1; lbx1h;
                     SI:zC207O21.2; wu:fc26c12; zgc:92170"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    292..294
                     /gene="lbx2"
                     /gene_synonym="fc26c12; homeobox; lbx; lbx1; lbx1h;
                     SI:zC207O21.2; wu:fc26c12; zgc:92170"
                     /note="upstream in-frame stop codon"
     CDS             310..1083
                     /gene="lbx2"
                     /gene_synonym="fc26c12; homeobox; lbx; lbx1; lbx1h;
                     SI:zC207O21.2; wu:fc26c12; zgc:92170"
                     /note="lady bird-like homeobox 1 homolog; ladybird
                     homeobox homolog 1; ladybird homeobox homolog 2"
                     /codon_start=1
                     /product="transcription factor LBX2"
                     /protein_id="NP_001007135.1"
                     /db_xref="GeneID:64276"
                     /db_xref="ZFIN:ZDB-GENE-001206-2"
                     /translation="
MTSSSKDMKAGSVLQSSGEERRRGPLDQLPPPANSNKPLTPFSIEDILNKPSVKKSVGSLCPPRVLEKVTGSSASRNGISAPSSPLCALEELASKTFKGLEVSVIQAAEGREHINAFGQRQASKKRRKSRTAFTNHQIYELEKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKLKRDLEEMKADVESLKKIPPQALQKLVSMEDMEDAHGGSGPISPSLSPRAFPQSPSSSRGQTTDEFSEEDEEIEVDD"
     misc_feature    order(688..702,706..708,757..759,775..777,814..816,
                     820..825,832..837,841..849,853..858)
                     /gene="lbx2"
                     /gene_synonym="fc26c12; homeobox; lbx; lbx1; lbx1h;
                     SI:zC207O21.2; wu:fc26c12; zgc:92170"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    694..855
                     /gene="lbx2"
                     /gene_synonym="fc26c12; homeobox; lbx; lbx1; lbx1h;
                     SI:zC207O21.2; wu:fc26c12; zgc:92170"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:278475"
     misc_feature    order(694..696,703..705,823..825,832..837,844..846)
                     /gene="lbx2"
                     /gene_synonym="fc26c12; homeobox; lbx; lbx1; lbx1h;
                     SI:zC207O21.2; wu:fc26c12; zgc:92170"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     exon            638..1738
                     /gene="lbx2"
                     /gene_synonym="fc26c12; homeobox; lbx; lbx1; lbx1h;
                     SI:zC207O21.2; wu:fc26c12; zgc:92170"
                     /inference="alignment:Splign:2.1.0"
     STS             1371..1574
                     /gene="lbx2"
                     /gene_synonym="fc26c12; homeobox; lbx; lbx1; lbx1h;
                     SI:zC207O21.2; wu:fc26c12; zgc:92170"
                     /standard_name="fc26c12.x1"
                     /db_xref="UniSTS:193303"
     STS             1472..1573
                     /gene="lbx2"
                     /gene_synonym="fc26c12; homeobox; lbx; lbx1; lbx1h;
                     SI:zC207O21.2; wu:fc26c12; zgc:92170"
                     /standard_name="fc26c12.x1"
                     /db_xref="UniSTS:193302"
ORIGIN      
tgaacttcacaaaagcaatcaacaagaactcgttagcggttgcttgctgttttgaggctccttgagacactaaggctacacacggtgaagatcttcatggagcagctcagagaacaccgcgtatgaggactaaagttcgggtgccttcctgcatgtgacgcctgaagcatggtgcttttggagagcctcttcagagtgaggaacaacaacgattttttgtaaagaaaggaacagacaaggcttttgtatgtataaacaagtttgagcgagctaggtgacttctattcgaaatagtttcttgggactgagatgacctccagctctaaagacatgaaagcaggatccgttttgcagtccagcggcgaggagaggcggcggggtcccttggaccaactcccacctccggccaactccaacaagcctctcaccccgttcagcattgaggatatcttaaacaagccctccgttaagaagtccgtcggtagtttgtgccctccgcgggtgctggagaaagtaaccggctcgagcgcatctcggaacgggatcagcgccccgtcctcgccgttgtgcgcgctggaggagctggcgagcaaaacatttaagggtttggaagtcagcgttatacaagcagcagaaggtcgtgaacacatcaacgcctttggccaaagacaggcatccaaaaaacgacggaagtcccgcacagccttcaccaaccaccaaatctacgagctggaaaagaggtttttgtaccagaaatacctctcaccggctgacagagaccagatagcacagcagctggggctgaccaatgcgcaggtcatcacctggttccagaaccgacgggccaagctcaagagagatctggaggagatgaaggcggacgtagagtctctcaagaaaatcccaccacaggcattgcagaaactggtgtccatggaggacatggaagacgctcacggtggctcggggcccatttctcccagtctttccccaagagcctttccacagtccccatcctcgtccagaggccaaaccacagacgagttctcagaggaggacgaggaaatcgaggtggacgattaaacgcaggcccttgttttcagagaagggcatttttcacgactttttgcacggaagaacttgaaatgcaaggaacgttttctgtctcccttatttttaatttattgaaaggacctctacattctgacgtccagatggaagacacggttttaaggaatacgctttcataagaaacacttagagataaatggtacagtatcaagactgcaaaaagtgtatgtacattttaagctttatttctccatttcttttctcaaaggaaacctgtgcaattgtttacaccatttatgacacacatttatgaacgctgtagaaattcttaagccaaaagtgattttcaattcagttttcagctgagtagaattatatatttataaataatttcagaacacaagatgtcctcagaaaccttttttttcagtcttggttctgcactgtaatttcccaaagtttgacattatgtatcccagttcctgacacaattcctacaggcattatttacaaattattaaaaaaaaagatgtatgtccaaaacaatgcaagggcaaggttgtgtatatatataacaagttatgatgcatctaactcgttaaatttattgtaacattctatttaatcctcatttatgtaaataaagggtatatgtaatttcacaatgaaaaaaaaaaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]